Recombinant Human Receptor-type tyrosine-protein phosphatase zeta | MyBioSource MBS948562 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Receptor-type tyrosine-protein phosphatase zeta

catalog :

MBS948562

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS948562

products type :

Recombinant Protein

products full name :

Recombinant Human Receptor-type tyrosine-protein phosphatase zeta

products short name :

Receptor-type tyrosine-protein phosphatase zeta

products name syn :

Protein-tyrosine phosphatase receptor type Z polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 2; R-PTP-zeta-2

other names :

receptor-type tyrosine-protein phosphatase zeta isoform 2; Receptor-type tyrosine-protein phosphatase zeta; receptor-type tyrosine-protein phosphatase zeta; protein tyrosine phosphatase, receptor type Z1; Protein-tyrosine phosphatase receptor type Z polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 2; R-PTP-zeta-2

products gene name :

PTPRZ1

other gene names :

PTPRZ1; PTPRZ1; PTPZ; HPTPZ; PTP18; PTPRZ; RPTPB; HPTPzeta; PTP-ZETA; RPTPbeta; phosphacan; R-PTP-zeta-2; HTPZP2; PTPRZ; PTPRZ2; PTPZ; R-PTP-zeta

uniprot entry name :

PTPRZ_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

36-300

sequence length :

1455

sequence :

IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVN
VNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVS
GGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLE
MQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENL
DFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYI
YNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTM
QQSGYVMLMDYLQNNFREQQY

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Neuroscience

products description :

Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual mory, probably via the dephosphorylation of proteins that are part of important signaling cascades.

products references :

A human transmembrane protein-tyrosine-phosphatase, PTP zeta, is expressed in brain and has an N-terminal receptor domain homologous to carbonic anhydrases.Krueger N.X., Saito H.Proc. Natl. Acad. Sci. U.S.A. 89:7417-7421(1992) The cloning of a receptor-type protein tyrosine phosphatase expressed in the central nervous system.Levy J.B., Canoll P.D., Silvennoinen O., Barnea G., Morse B., Honegger A.M., Huang J.-T., Cannizzaro L.A., Park S.-H., Druck T., Huebner K., Sap J., Ehrlich M., Musacchio J.M., Schlessinger J.J. Biol. Chem. 268:10573-10581(1993) The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003) Human chromosome 7 DNA sequence and biology.Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S., Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.Science 300:767-772(2003)

ncbi gi num :

332205943

ncbi acc num :

NP_001193767.1

ncbi gb acc num :

NM_001206838.1

uniprot acc num :

P23471

ncbi mol weight :

46.1kD

ncbi pathways :

Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway (83102); Epithelial Cell Signaling In Helicobacter Pylori Infection Pathway (515); Spinal Cord Injury Pathway (739007)

ncbi summary :

This gene encodes a member of the receptor protein tyrosine phosphatase family. Expression of this gene is restricted to the central nervous system (CNS), and it may be involved in the regulation of specific developmental processes in the CNS. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, May 2011]

uniprot summary :

PTPRZ1: May be involved in the regulation of specific developmental processes in the CNS. Belongs to the protein-tyrosine phosphatase family. Receptor class 5 subfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; EC 3.1.3.48; Receptor protein phosphatase, tyrosine. Chromosomal Location of Human Ortholog: 7q31.3. Cellular Component: axon; cell soma; cytoplasm; dendritic spine; extracellular space; filopodium; growth cone; integral to plasma membrane; lamellipodium; postsynaptic membrane; proteinaceous extracellular matrix. Molecular Function: fibroblast growth factor binding; protein binding; protein tyrosine phosphatase activity; transmembrane receptor protein tyrosine phosphatase activity. Biological Process: axonal fasciculation; axonogenesis; central nervous system development; hemopoietic progenitor cell differentiation; hippocampus development; learning and/or memory; negative regulation of cell proliferation; oligodendrocyte differentiation; positive regulation of fibroblast proliferation; positive regulation of peptidyl-tyrosine phosphorylation; protein amino acid dephosphorylation; regulation of dendrite morphogenesis; visual learning. Disease: Helicobacter Pylori Infection, Susceptibility To

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage