protein

Recombinant Human Aquaporin-1

MBS948542

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Aquaporin-1

Aquaporin-1

Aquaporin-CHIP; Urine water channel; Water channel protein for red blood cells and kidney proximal tubule

aquaporin-1 isoform 2; Aquaporin-1; aquaporin-1; aquaporin 1 (Colton blood group); Aquaporin-CHIP; Urine water channel; Water channel protein for red blood cells and kidney proximal tubule

AQP1

AQP1; AQP1; CO; CHIP28; AQP-CHIP; CHIP28; AQP-1

AQP1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

220-269, Partial

269

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDAD
DINSRVEMKPK

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Transport

Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Isolation of the cDNA for erythrocyte integral membrane protein of 28 kilodaltons member of an ancient channel family.Preston G.M., Agre P.Proc. Natl. Acad. Sci. U.S.A. 88:11110-11114(1991) The human aquaporin-CHIP gene. Structure, organization, and chromosomal localization.Moon C., Preston G.M., Griffin C.A., Jabs E.W., Agre P.J. Biol. Chem. 268:15772-15778(1993) Characterization of the 3' UTR sequence encoded by the AQP-1 gene in human retinal pigment epithelium.Ruiz A.C., Bok D.Biochim. Biophys. Acta 1282:174-178(1996) The water channel gene in human uterus.Li X., Yu H., Koide S.S.Biochem. Mol. Biol. Int. 32:371-377(1994) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) SeattleSNPs variation discovery resourceHuman protein factory for converting the transcriptome into an in vitro-expressed proteome.Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B., Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.Nat. Methods 5:1011-1017(2008) The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003)

297307116

NP_001171989.1

NM_001185060.1

P29972

21.6kD

Aquaporin-mediated Transport Pathway (1269944); Bile Secretion Pathway (193146); Bile Secretion Pathway (193095); Erythrocytes Take Up Carbon Dioxide And Release Oxygen Pathway (1270224); Erythrocytes Take Up Oxygen And Release Carbon Dioxide Pathway (1270225); Metabolism Pathway (1269956); O2/CO2 Exchange In Erythrocytes Pathway (1270223); Passive Transport By Aquaporins Pathway (1269945); Proximal Tubule Bicarbonate Reclamation Pathway (144182); Proximal Tubule Bicarbonate Reclamation Pathway (144027)

Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). This gene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayer spanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant in erythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involving imbalance in ocular fluid movement. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

AQP1: Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Belongs to the MIP/aquaporin (TC 1.A.8) family. Protein type: Transporter, aquaporin family; Membrane protein, multi-pass; Transporter; Membrane protein, integral. Chromosomal Location of Human Ortholog: 7p14. Cellular Component: apical part of cell; apical plasma membrane; basal plasma membrane; basolateral plasma membrane; brush border; brush border membrane; cytoplasm; integral to plasma membrane; nerve terminal; nuclear membrane; nucleus; plasma membrane; sarcolemma. Molecular Function: ammonium transmembrane transporter activity; ephrin receptor binding; glycerol channel activity; glycerol transmembrane transporter activity; intracellular cGMP activated cation channel activity; nitric oxide transporter activity; potassium channel activity; potassium ion transmembrane transporter activity; protein binding; transmembrane transporter activity; water channel activity; water transporter activity. Biological Process: adrenocorticotropin hormone secretion; ammonium transport; bicarbonate transport; camera-type eye morphogenesis; carbon dioxide transport; cell volume homeostasis; cellular homeostasis; cellular response to stress; cerebrospinal fluid secretion; cGMP biosynthetic process; establishment and/or maintenance of actin cytoskeleton polarity; glomerular filtration; glycerol transport; hyperosmotic salinity response; lateral ventricle development; lipid digestion; multicellular organismal water homeostasis; negative regulation of apoptosis; negative regulation of caspase activity; nitric oxide transport; odontogenesis; pancreatic juice secretion; positive regulation of angiogenesis; positive regulation of fibroblast proliferation; positive regulation of saliva secretion; potassium ion transport; renal water homeostasis; renal water transport; response to drug; response to estrogen stimulus; secretory granule organization and biogenesis; sensory perception of pain; transmembrane transport; water transport; wound healing. Disease: Blood Group--colton

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

0.05 mg (Baculovirus)

775

0.05 mg (Mammalian-Cell)

1000