protein

Recombinant Human Bone morphogenetic protein 3

MBS948539

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Bone morphogenetic protein 3

Bone morphogenetic protein 3

Bone morphogenetic protein 3A; BMP-3A; Osteogenin

bone morphogenetic protein 3 preproprotein; Bone morphogenetic protein 3; bone morphogenetic protein 3; bone morphogenetic protein 3; Bone morphogenetic protein 3A; BMP-3A; Osteogenin

BMP3

BMP3A

BMP3; BMP3; BMP-3A; BMP3A; BMP-3; BMP-3A

BMP3_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

363-472

472

KQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCS
GACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVP
EKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Developmental Biology

Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.

Novel regulators of bone formation molecular clones and activities.Wozney J.M., Rosen V., Celeste A.J., Mitsock L.M., Whitters M.J., Kriz R.W., Hewick R.M., Wang E.A.Science 242:1528-1534(1988) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Bone morphogenetic protein-3 is a negative regulator of bone density.Daluiski A., Engstrand T., Bahamonde M.E., Gamer L.W., Agius E., Stevenson S.L., Cox K., Rosen V., Lyons K.M.Nat. Genet. 27:84-88(2001) BMP signaling components are expressed in human fracture callus.Kloen P., Di Paola M., Borens O., Richmond J., Perino G., Helfet D.L., Goumans M.J.Bone 33:362-371(2003) Characterization of the distinct orthotopic bone-forming activity of 14 BMPs using recombinant adenovirus-mediated gene delivery.Kang Q., Sun M.H., Cheng H., Peng Y., Montag A.G., Deyrup A.T., Jiang W., Luu H.H., Luo J., Szatkowski J.P., Vanichakarn P., Park J.Y., Li Y., Haydon R.C., He T.-C.Gene Ther. 11:1312-1320(2004) Expression of bone morphogenetic proteins, receptors, and tissue inhibitors in human fetal, adult, and osteoarthritic articular cartilage.Chen A.L., Fang C., Liu C., Leslie M.P., Chang E., Di Cesare P.E.J. Orthop. Res. 22:1188-1192(2004) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) BMP-3 and BMP-6 structures illuminate the nature of binding specificity with receptors.Allendorph G.P., Isaacs M.J., Kawakami Y., Izpisua Belmonte J.C., Choe S.Biochemistry 46:12238-12247(2007)

126507087

NP_001192.2

NM_001201.2

P12645

16.6kD

Adipogenesis Pathway (198832)

BMP3 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein, also known as osteogenin, induces bone formation. [provided by RefSeq, Jul 2008]

BMP3: Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Belongs to the TGF-beta family. Protein type: Secreted; Secreted, signal peptide; Cytokine. Chromosomal Location of Human Ortholog: 4q21. Cellular Component: extracellular space. Molecular Function: cytokine activity; growth factor activity; receptor binding; transforming growth factor beta receptor binding. Biological Process: BMP signaling pathway; cartilage development; cell development; cell-cell signaling; growth; osteoblast differentiation; positive regulation of transcription from RNA polymerase II promoter; regulation of apoptosis; regulation of MAPKKK cascade; skeletal development

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

0.05 mg (Baculovirus)

845

0.05 mg (Mammalian-Cell)

1070