Recombinant Rat H-2 class II histocompatibility antigen gamma chain | MyBioSource MBS948464 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Rat H-2 class II histocompatibility antigen gamma chain

catalog :

MBS948464

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS948464

products type :

Recombinant Protein

products full name :

Recombinant Rat H-2 class II histocompatibility antigen gamma chain

products short name :

H-2 class II histocompatibility antigen gamma chain

products name syn :

Ia antigen-associated invariant chain; IiMHC class II-associated invariant chain; CD74

other names :

H-2 class II histocompatibility antigen gamma chain; H-2 class II histocompatibility antigen gamma chain; H-2 class II histocompatibility antigen gamma chain; CD74 molecule; Ia antigen-associated invariant chain; Ii; MHC class II-associated invariant chain; CD_antigen: CD74

products gene name :

Cd74

other gene names :

Cd74; Cd74; INVG34; Ii

uniprot entry name :

HG2A_RAT

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

57-280

sequence length :

216

sequence :

QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMAT
PLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSG
PVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLL
FEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAF
RPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRG
RHNCSEPLDMEDPSSGLGVTKQDMGQMFL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

products references :

Sequence of a rat MHC class II-associated invariant chain cDNA clone containing a 64 amino acid thyroglobulin-like domain.McKnight A.J., Mason D.W., Barclay A.N.Nucleic Acids Res. 17:3983-3984(1989) Nucleotide sequence of rat invariant gamma chain cDNA clone pLR gamma 34.3.Henkes W., Syha J., Reske K.Nucleic Acids Res. 16:11822-11822(1988)

ncbi gi num :

6978637

ncbi acc num :

NP_037201.1

ncbi gb acc num :

NM_013069.2

uniprot acc num :

P10247

ncbi mol weight :

29.5kD

ncbi pathways :

Adaptive Immune System Pathway (1332755); Antigen Processing And Presentation Pathway (83466); Antigen Processing And Presentation Pathway (485); Cell Surface Interactions At The Vascular Wall Pathway (1333067); Hemostasis Pathway (1333034); Herpes Simplex Infection Pathway (377869); Herpes Simplex Infection Pathway (377865); Immune System Pathway (1332754); MHC Class II Antigen Presentation Pathway (1332783); Tuberculosis Pathway (213777)

uniprot summary :

CD74: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF. A chromosomal aberration involving CD74 is found in a non-small cell lung tumor. Results in the formation of a CD74- ROS1 chimeric protein. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Endoplasmic reticulum; Membrane protein, integral; Receptor, cytokine. Cellular Component: cell surface; endoplasmic reticulum; external side of plasma membrane; Golgi apparatus; integral to membrane; late endosome; lysosome; membrane; MHC class II protein complex; multivesicular body; plasma membrane; vacuole. Molecular Function: beta-amyloid binding; cytokine binding; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; MHC class II protein binding; MHC class II protein binding, via antigen binding groove; nitric-oxide synthase binding. Biological Process: activation of MAPK activity; antigen processing and presentation; antigen processing and presentation of exogenous peptide antigen via MHC class II; cell proliferation; chaperone cofactor-dependent protein folding; defense response; immunoglobulin mediated immune response; intracellular protein transport; negative regulation of apoptosis; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of mature B cell apoptosis; negative regulation of peptide secretion; negative regulation of T cell differentiation; negative thymic T cell selection; positive regulation of B cell proliferation; positive regulation of cytokine and chemokine mediated signaling pathway; positive regulation of dendritic cell antigen processing and presentation; positive regulation of fibroblast proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of T cell differentiation; positive regulation of T-helper 2 type immune response; positive thymic T cell selection; prostaglandin biosynthetic process; protein complex assembly; signal transduction

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

975

size5 :

1 mg (E-Coli)

price5 :

1180

more info or order :

MyBioSource product webpage