This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MyBioSource
product type :
protein
product name :
Recombinant Pig Vimentin (VIM)
catalog :
MBS948374
quantity :
1 mg (E Coli Derived
price :
1545 USD
product information
catalog number :
MBS948374
products type :
Recombinant Protein
products full name :
Recombinant Pig Vimentin (VIM)
products short name :
Vimentin (VIM)
products name syn :
Recombinant Vimentin (VIM); Vimentin
other names :
PREDICTED: vimentin-like; Vimentin; vimentin-like
products gene name syn :
VIM
other gene names :
LOC100522394; VIM; VIM; Vimentin
uniprot entry name :
VIME_PIG
host :
E Coli or Yeast
sequence positions :
1-275
sequence length :
466
sequence :
STRTVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSL
GSALRPSTSRSLSTSSPGGVGYYATRSSAVRLRSSVPGV
RLLQDAVDFSLADAINTEFKWYKSKFADLSEAANRNNDA
LRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREM
EENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRE
TNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQHHND
LE
purity :
>90%
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Sus scrofa (Pig)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi gi num :
335296459
ncbi acc num :
XP_003130769.2
ncbi gb acc num :
XM_003130721.3
uniprot acc num :
P02543
ncbi mol weight :
53,668 Da
ncbi pathways :
Apoptosis Pathway 832421!!Apoptotic Cleavage Of Cellular Proteins Pathway 832445!!Apoptotic Execution Phase Pathway 832444!!Caspase-mediated Cleavage Of Cytoskeletal Proteins Pathway 832446!!Epstein-Barr Virus Infection Pathway 585586!!Epstein-Barr Virus Infection Pathway 587115!!Muscle Contraction Pathway 831324!!Striated Muscle Contraction Pathway 831325
uniprot summary :
Function: Vimentins are class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is attached to the nucleus, endoplasmic reticulum, and mitochondria, either laterally or terminally.Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2 . By similarity. Subunit structure: Homopolymer assembled from elementary dimers. Interacts with LGSN and SYNM. Interacts (via rod region) with PLEC (via CH 1 domain). Interacts with SLC6A4 . By similarity. Interacts with STK33 . By similarity. Interacts with LARP6 . By similarity. Interacts with RAB8B . By similarity. Domain: The central alpha-helical coiled-coil rod region mediates elementary homodimerization . By similarity. Post-translational modification: One of the most prominent phosphoproteins in various cells of mesenchymal origin. Phosphorylation is enhanced during cell division, at which time vimentin filaments are significantly reorganized. Phosphorylation by PKN1 inhibits the formation of filaments. Filament disassembly during mitosis is promoted by phosphorylation at Ser-55 as well as by nestin. Phosphorylated at Ser-56 by CDK5 during neutrophil secretion in the cytoplasm. Phosphorylated by STK33 . By similarity. Sequence similarities: Belongs to the intermediate filament family.
size :
1 mg (E Coli Derived)
price :
1545 USD
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!