catalog number :
MBS948374
products type :
Recombinant Protein
products full name :
Recombinant Pig Vimentin (VIM)
products short name :
Vimentin (VIM)
products name syn :
Recombinant Vimentin (VIM); Vimentin
other names :
PREDICTED: vimentin-like; Vimentin; vimentin-like
products gene name syn :
VIM
other gene names :
LOC100522394; VIM; VIM; Vimentin
uniprot entry name :
VIME_PIG
sequence positions :
1-275
sequence :
STRTVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSL
GSALRPSTSRSLSTSSPGGVGYYATRSSAVRLRSSVPGV
RLLQDAVDFSLADAINTEFKWYKSKFADLSEAANRNNDA
LRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREM
EENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRE
TNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQHHND
LE
form :
This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Tag Information: His tagged (Host tag may vary. Please inquire for specific tag information). Species: Sus scrofa (Pig)
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
ncbi acc num :
XP_003130769.2
ncbi gb acc num :
XM_003130721.3
ncbi mol weight :
53,668 Da
ncbi pathways :
Apoptosis Pathway 832421!!Apoptotic Cleavage Of Cellular Proteins Pathway 832445!!Apoptotic Execution Phase Pathway 832444!!Caspase-mediated Cleavage Of Cytoskeletal Proteins Pathway 832446!!Epstein-Barr Virus Infection Pathway 585586!!Epstein-Barr Virus Infection Pathway 587115!!Muscle Contraction Pathway 831324!!Striated Muscle Contraction Pathway 831325
uniprot summary :
Function: Vimentins are class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is attached to the nucleus, endoplasmic reticulum, and mitochondria, either laterally or terminally.Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2 . By similarity. Subunit structure: Homopolymer assembled from elementary dimers. Interacts with LGSN and SYNM. Interacts (via rod region) with PLEC (via CH 1 domain). Interacts with SLC6A4 . By similarity. Interacts with STK33 . By similarity. Interacts with LARP6 . By similarity. Interacts with RAB8B . By similarity. Domain: The central alpha-helical coiled-coil rod region mediates elementary homodimerization . By similarity. Post-translational modification: One of the most prominent phosphoproteins in various cells of mesenchymal origin. Phosphorylation is enhanced during cell division, at which time vimentin filaments are significantly reorganized. Phosphorylation by PKN1 inhibits the formation of filaments. Filament disassembly during mitosis is promoted by phosphorylation at Ser-55 as well as by nestin. Phosphorylated at Ser-56 by CDK5 during neutrophil secretion in the cytoplasm. Phosphorylated by STK33 . By similarity. Sequence similarities: Belongs to the intermediate filament family.
size :
1 mg (E Coli Derived)