catalog number :
MBS948249
products type :
Recombinant Protein
products full name :
Recombinant Human Secreted Ly-6/uPAR-related protein 1
products short name :
Secreted Ly-6/uPAR-related protein 1
products name syn :
ARS component B; ARS(component B)-81/S; Anti-neoplastic urinary protein; ANUP
other names :
secreted Ly-6/uPAR-related protein 1; Secreted Ly-6/uPAR-related protein 1; secreted Ly-6/uPAR-related protein 1; secreted LY6/PLAUR domain containing 1; ARS component B; ARS(component B)-81/S; Anti-neoplastic urinary protein; ANUP
products gene name :
SLURP1
other gene names :
SLURP1; SLURP1; ARS; MDM; ANUP; ArsB; LY6LS; ARS; SLURP-1; ANUP
uniprot entry name :
SLUR1_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
23-103
sequence :
LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEY
PFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCN
SEL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens (Human)
products categories :
Cardiovascular
products description :
Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.
products references :
Biological effects of SLURP-1 on human keratinocytes." Arredondo J., Chernyavsky A.I., Webber R.J., Grando S.A. J. Invest. Dermatol. 125:1236-1241(2005)
ncbi acc num :
NP_065160.1
ncbi gb acc num :
NM_020427.2
ncbi mol weight :
12.95kD
ncbi summary :
The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq, Jul 2008]
uniprot summary :
SLURP1: Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. Defects in SLURP1 are a cause of Mal de Meleda (MDM); also known as keratosis palmoplantaris transgradiens of Siemens. MDM is a rare autosomal recessive skin disorder, characterized by diffuse transgressive palmoplantar keratoderma with keratotic lesions extending onto the dorsa of the hands and the feet (transgrediens). Patients may have hyperhidrosis. Other features include perioral erythema, lichenoid plaques on the knees and the elbows, and nail abnormalities. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 8q24.3. Cellular Component: extracellular region; extracellular space. Molecular Function: cytokine activity. Biological Process: cell activation; cell adhesion; locomotory behavior; neuromuscular process controlling posture. Disease: Mal De Meleda
size4 :
0.05 mg (Baculovirus)
size5 :
0.05 mg (Mammalian-Cell)