product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Yorkie homolog (Yap1)
catalog :
MBS948217
quantity :
1 mg (E-Coli)
price :
2035 USD
more info or order :
product information
catalog number :
MBS948217
products type :
Recombinant Protein
products full name :
Recombinant Mouse Yorkie homolog (Yap1)
products short name :
Yorkie homolog (Yap1)
products name syn :
Recombinant Yorkie homolog (Yap1); Yorkie homolog; 65 kDa Yes-associated protein; YAP65
other names :
yorkie homolog isoform 1; Yorkie homolog; yorkie homolog; 65 kDa Yes-associated protein; yes-associated protein, 65 kDa; yes-associated protein 1; 65 kDa Yes-associated protein
products gene name syn :
Yap1; Yap, Yap65
other gene names :
Yap1; Yap1; Yap; Yki; Yap65; Yorkie; AI325207; Yap; Yap65; YAP65
uniprot entry name :
YAP1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-488
sequence length :
488
sequence :
MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQV
VHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPD
SFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASL
QLGAVSPGTLTASGVVSGPAAAPAAQHLRQSSFEIPDDV
PLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQL
NVPAPASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYI
NHKNKTTSWLDPRLDPRFAMNQRITQSAPVKQPPPLAPQ
SPQGGVLGGGSSNQQQQIQLQQLQMEKERLRLKQQELFR
QAIRNINPSTANAPKCQELALRSQLPTLEQDGGTPNAVS
SPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMS
SYSIPRTPDDFLNSVDEMDTGDTISQSTLPSQQSRFPDY
LEALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEIL
DVESVLAATKLDKESFLTWL
purity :
>90%(SDS-PAGE)
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Species: Mus musculus (Mouse)
products description :
Transcriptional regulator which canact both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction.
ncbi gi num :
283945493
ncbi acc num :
NP_001164618.1
ncbi gb acc num :
NM_001171147.1
uniprot acc num :
P46938
ncbi mol weight :
58kD
ncbi pathways :
Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway (639898); Gene Expression Pathway (640300); Generic Transcription Pathway (640301); Metabolism Pathway (639859); Metabolism Of Lipids And Lipoproteins Pathway (639889); Nuclear Signaling By ERBB4 Pathway (639704); PPARA Activates Gene Expression Pathway (639918); Regulation Of Lipid Metabolism By Peroxisome Proliferator-activated Receptor Alpha (PPARalpha) Pathway (639917); Signal Transduction Pathway (639624); Signaling By ERBB4 Pathway (639701)
ncbi summary :
This gene encodes a protein which binds to the SH3 domain of the Yes proto-oncogene product, a tyrosine kinase. This protein contains a WW domain, consisting of four conserved aromatic amino acids including two tryptophan residues. This conserved WW domain is found in various structural, regulatory and signaling molecules in various species, and may play a role in protein-protein interaction. Following cellular damage, phosphorylation of this encoded protein may suppress apoptosis. This protein may be involved in malignant transformation in cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2010]
uniprot summary :
YAP1: an adaptor protein that binds to HER4 and the SH3 domain of the Yes tyrosine kinase. Associates with multiple transcription factors in the nucleus, and appears to be a co-transcriptional activator for the carboxyl-terminal fragment of ErbB-4 that translocates to the nucleus. Contains a WW domain that is found in various structural, regulatory and signaling molecules. Protein type: Oncoprotein; Transcription, coactivator/corepressor. Cellular Component: nucleoplasm; transcription factor complex; membrane; cytoplasm; cell junction; cytosol; nucleus. Molecular Function: protein C-terminus binding; protein binding; transcription coactivator activity; chromatin binding; transcription corepressor activity. Biological Process: transcription from RNA polymerase II promoter; paraxial mesoderm development; transcription, DNA-dependent; somatic stem cell maintenance; lateral mesoderm development; cell morphogenesis; negative regulation of epithelial cell differentiation; notochord development; positive regulation of organ growth; regulation of cell proliferation; keratinocyte differentiation; regulation of transcription from RNA polymerase II promoter; cell proliferation; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; vasculogenesis; response to DNA damage stimulus
size1 :
1 mg (E-Coli)
price1 :
2035 USD
size2 :
1 mg (Yeast)
price2 :
2495
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!