protein

Recombinant Human Rho guanine nucleotide exchange factor 18

MBS948154

0.01 mg (E-Coli)

135 USD

Recombinant Protein

Recombinant Human Rho guanine nucleotide exchange factor 18

Rho guanine nucleotide exchange factor 18

Opsin-2

rhodopsin; Rhodopsin; rhodopsin; rhodopsin; Opsin-2

ARHGEF18

RHO; RHO; RP4; OPN2; CSNBAD1; OPN2

OPSD_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

Jan-36

348

MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQ

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Species: Homo sapiens (Human)

Signal Transduction

Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal.

Isolation and nucleotide sequence of the gene encoding human rhodopsin." Nathans J., Hogness D.S. Proc. Natl. Acad. Sci. U.S.A. 81:4851-4855(1984)

4506527

NP_000530.1

NM_000539.3

P08100

20.15kD

Activation Of The Phototransduction Cascade Pathway (1269628); Assembly Of The Primary Cilium Pathway (1268846); Cargo Trafficking To The Periciliary Membrane Pathway (1268848); Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); G Alpha (i) Signalling Events Pathway (1269576); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); GPCRs, Class A Rhodopsin-like Pathway (198886); Inactivation, Recovery And Regulation Of The Phototransduction Cascade Pathway (1269629); Integrated Breast Cancer Pathway (219801)

Retinitis pigmentosa is an inherited progressive disease which is a major cause of blindness in western communities. It can be inherited as an autosomal dominant, autosomal recessive, or X-linked recessive disorder. In the autosomal dominant form,which comprises about 25% of total cases, approximately 30% of families have mutations in the gene encoding the rod photoreceptor-specific protein rhodopsin. This is the transmembrane protein which, when photoexcited, initiates the visual transduction cascade. Defects in this gene are also one of the causes of congenital stationary night blindness. [provided by RefSeq, Jul 2008]

Rhodopsin: a G-protein coupled receptor. The light-absorbing visual pigment in Rod photoreceptor cells. Mediates vision in dim light. Consists of the apoprotein, opsin, covalently linked to cis-retinal. Defects in RHO are a cause of autosomal retinitis pigmentosa and congenital stationary night blindness. Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR. Chromosomal Location of Human Ortholog: 3q21-q24. Cellular Component: Golgi apparatus; Golgi membrane; integral to plasma membrane; intercellular junction; photoreceptor inner segment; photoreceptor outer segment; plasma membrane; rough endoplasmic reticulum membrane. Molecular Function: G-protein coupled receptor activity; metal ion binding; photoreceptor activity; protein binding; retinal binding. Biological Process: absorption of visible light; G-protein coupled receptor protein signaling pathway; organelle organization and biogenesis; photoreceptor cell maintenance; phototransduction, visible light; protein amino acid phosphorylation; protein-chromophore linkage; red, far-red light phototransduction; regulation of rhodopsin mediated signaling; retina development in camera-type eye; retinoid metabolic process; rhodopsin mediated signaling; visual perception. Disease: Fundus Albipunctatus; Night Blindness, Congenital Stationary, Autosomal Dominant 1; Retinitis Pigmentosa 4

0.01 mg (E-Coli)

135 USD

0.05 mg (E-Coli)

255

0.2 mg (E-Coli)

665

0.5 mg (Yeast)

990

0.5 mg (E-Coli)

1090