product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Lymphotoxin-alpha (Lta)
catalog :
MBS948127
quantity :
0.05 mg (Mammalian-C
price :
808 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS948127
products type :
Recombinant Protein
products full name :
Recombinant Mouse Lymphotoxin-alpha (Lta)
products short name :
Lymphotoxin-alpha (Lta)
products name syn :
Lymphotoxin-alpha; LT-alpha; TNF-beta; Tumor necrosis factor ligand superfamily member 1
other names :
lymphotoxin-alpha; Lymphotoxin-alpha; lymphotoxin-alpha; TNF beta; lymphotoxin alpha; tumor necrosis factor ligand superfamily member 1; lymphotoxin A; TNF-beta; Tumor necrosis factor ligand superfamily member 1
products gene name :
Lta
products gene name syn :
Lta; Tnfb; Tnfsf1
other gene names :
Lta; Lta; LT; Ltx; Tnfb; LT[a]; LT-[a]; TNFSF1; hlb382; LTalpha; Tnfsf1b; LT-alpha; TNF-beta; Tnfb; Tnfsf1; LT-alpha
uniprot entry name :
TNFB_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
34-202, Mature full length protein.
sequence length :
202
sequence :
LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQN
SLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVV
FSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQK
SVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLH
FSPSSVFFGAFAL
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mus musculus (Mouse)
ncbi gi num :
7106343
ncbi acc num :
NP_034865.1
ncbi gb acc num :
NM_010735.2
uniprot acc num :
P09225
ncbi mol weight :
21,999 Da
ncbi pathways :
Apoptosis Pathway (198339); Cytokine-cytokine Receptor Interaction Pathway (83248); Cytokine-cytokine Receptor Interaction Pathway (460); HTLV-I Infection Pathway (373903); HTLV-I Infection Pathway (373889); Herpes Simplex Infection Pathway (377874); Herpes Simplex Infection Pathway (377865); NF-kappa B Signaling Pathway (634537); TNF Signaling Pathway (812263); TNF Signaling Pathway (813210)
uniprot summary :
LTA: Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo. Genetic variations in LTA are a cause of susceptibility psoriatic arthritis (PSORAS). PSORAS is an inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoidlike pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis). Belongs to the tumor necrosis factor family. Protein type: Apoptosis; Secreted; Cytokine; Secreted, signal peptide. Cellular Component: extracellular space; membrane; extracellular region. Molecular Function: protein binding; cytokine activity; tumor necrosis factor receptor binding. Biological Process: positive regulation of humoral immune response mediated by circulating immunoglobulin; transformed cell apoptosis; positive regulation of apoptosis; lymph node development; humoral immune response; cell proliferation; defense response to Gram-positive bacterium; positive regulation of interferon-gamma production; negative regulation of fibroblast proliferation; positive regulation of cell proliferation; immune response; positive regulation of chronic inflammatory response to antigenic stimulus; inflammatory response; cellular process
size1 :
0.05 mg (Mammalian-Cell)
price1 :
808 USD
size2 :
0.5 mg (Yeast)
price2 :
808
size3 :
0.5 mg (E-Coli)
price3 :
915
size4 :
0.05 mg (Baculovirus)
price4 :
915
size5 :
1 mg (E-Coli)
price5 :
1330
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!