Recombinant Mouse Inositol 1,4,5-trisphosphate receptor type 3 (Itpr3), partial | MyBioSource MBS948082 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Inositol 1,4,5-trisphosphate receptor type 3 (Itpr3), partial

catalog :

MBS948082

quantity :

0.5 mg (E-Coli)

price :

895 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS948082

products type :

Recombinant Protein

products full name :

Recombinant Mouse Inositol 1,4,5-trisphosphate receptor type 3 (Itpr3), partial

products short name :

Inositol 1,4,5-trisphosphate receptor type 3 (Itpr3), partial

products name syn :

Recombinant Inositol 1,4,5-trisphosphate receptor type 3 (Itpr3), partial; Inositol 1,4,5-trisphosphate receptor type 3; IP3 receptor isoform 3; IP3R 3; InsP3R3 Type 3 inositol 1,4,5-trisphosphate receptor; Type 3 InsP3 receptor

other names :

inositol 1,4,5-trisphosphate receptor type 3; Inositol 1,4,5-trisphosphate receptor type 3; inositol 1,4,5-trisphosphate receptor type 3; IP3R 3; insP3R3; IP3 receptor; type 3 InsP3 receptor; type 3 inositol 1,4,5-trisphosphate receptor; inositol 1,4,5-triphosphate receptor 3; IP3 receptor isoform 3; IP3R 3; InsP3R3; Type 3 inositol 1,4,5-trisphosphate receptor

products gene name syn :

Itpr3

other gene names :

Itpr3; Itpr3; Ip3r3; Itpr-3; IP3R 3; InsP3R3

uniprot entry name :

ITPR3_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

2517-2670aa; Partial, provide the Cytoplasmic domain at the C-terminal.

sequence :

DTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIK
NKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMK
LVSHLTSQLNELKEQMTEQRKRRQRLGFVDVQNCMSR

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

other info1 :

Species: Mus musculus (Mouse)

ncbi gi num :

61102728

ncbi acc num :

NP_542120.2

ncbi gb acc num :

NM_080553.3

uniprot acc num :

P70227

ncbi mol weight :

304,275 Da

ncbi pathways :

Adaptive Immune System Pathway (640102); Alzheimer's Disease Pathway (83294); Alzheimer's Disease Pathway (509); Antigen Activates B Cell Receptor Leading To Generation Of Second Messengers Pathway (640114); Calcium Regulation In The Cardiac Cell Pathway (198327); Calcium Signaling Pathway (83247); Calcium Signaling Pathway (459); Cholinergic Synapse Pathway (217717); DAG And IP3 Signaling Pathway (639553); Disease Pathway (639547)

uniprot summary :

IP3R3: a multi-pass endoplasmic reticulum membrane receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium. Expressed in intestinal crypt and villus epithelial cells. The receptor contains a calcium channel in its C-terminal extremity. Its large N-terminal cytoplasmic region has the ligand-binding site in the N-terminus and modulatory sites in the middle portion immediately upstream of the channel region. Phosphorylated on tyrosine residues. Phosphorylated by AKT1 on serine and/or threonine residues. Belongs to the InsP3 receptor family. Protein type: Membrane protein, integral; Channel, calcium; Membrane protein, multi-pass; Channel, ligand-gated. Cellular Component: nuclear outer membrane; endoplasmic reticulum membrane; endoplasmic reticulum; integral to plasma membrane; dendrite; integral to membrane; nuclear envelope; cytosol; nucleoplasm; membrane; cell soma; apical part of cell; perinuclear region of cytoplasm; cytoplasm; plasma membrane; nucleolus; nucleus; myelin sheath; brush border; receptor complex. Molecular Function: protein binding; inositol 1,3,4,5 tetrakisphosphate binding; calcium channel activity; inositol hexakisphosphate binding; ion channel activity; calcium ion binding; intracellular ligand-gated calcium channel activity; phosphoinositide binding; inositol 1,4,5-triphosphate-sensitive calcium-release channel activity. Biological Process: inositol phosphate-mediated signaling; sensory perception of umami taste; sensory perception of sweet taste; protein heterooligomerization; memory; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; transport; calcium ion transport; ion transport; sensory perception of bitter taste; response to calcium ion; transmembrane transport; protein homooligomerization

size1 :

0.5 mg (E-Coli)

price1 :

895 USD

size2 :

0.05 mg (Baculovirus)

price2 :

895

size3 :

0.05 mg (Mammalian-Cell)

price3 :

1120

size4 :

0.5 mg (Yeast)

price4 :

1120

size5 :

1 mg (E-Coli)

price5 :

1295

more info or order :

MyBioSource product webpage