Recombinant Human ATP synthase subunit delta, mitochondrial | MyBioSource MBS948063 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human ATP synthase subunit delta, mitochondrial

catalog :

MBS948063

quantity :

0.05 mg (Yeast)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS948063

products type :

Recombinant Protein

products full name :

Recombinant Human ATP synthase subunit delta, mitochondrial

products short name :

ATP synthase subunit delta

products name syn :

F-ATPase delta subunit

other names :

ATP synthase subunit delta, mitochondrial; ATP synthase subunit delta, mitochondrial; ATP synthase subunit delta, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit; F-ATPase delta subunit

products gene name :

ATP5D

other gene names :

ATP5D; ATP5D

uniprot entry name :

ATPD_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

23-168, Mature full length protein

sequence length :

168

sequence :

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVP
TLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVS
SGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQA
ELVGTADEATRAEIQIRIEANEALVKALE

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Metabolism

products description :

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F1 domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha3beta3 subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.

products references :

Molecular cloning of an import precursor of the delta-subunit of the human mitochondrial ATP synthase complex.Jordan E.M., Breen G.A.M.Biochim. Biophys. Acta 1130:123-126(1992)

ncbi gi num :

50345991

ncbi acc num :

NP_001001975.1

ncbi gb acc num :

NM_001001975.1

uniprot acc num :

P30049

ncbi mol weight :

31.01kD

ncbi pathways :

Alzheimer's Disease Pathway (83097); Alzheimer's Disease Pathway (509); Electron Transport Chain Pathway (198860); F-type ATPase, Eukaryotes Pathway (522535); F-type ATPase, Eukaryotes Pathway (890450); Formation Of ATP By Chemiosmotic Coupling Pathway (1270129); Huntington's Disease Pathway (83100); Huntington's Disease Pathway (512); Metabolic Pathways (132956); Metabolism Pathway (1269956)

ncbi summary :

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008]

uniprot summary :

ATP5D: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Belongs to the ATPase epsilon chain family. Protein type: EC 3.6.3.14; Energy Metabolism - oxidative phosphorylation; Mitochondrial; Hydrolase. Chromosomal Location of Human Ortholog: 19p13.3. Cellular Component: mitochondrial inner membrane; mitochondrial matrix; mitochondrial proton-transporting ATP synthase complex; mitochondrion. Molecular Function: ADP binding; ATP binding; ATPase activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; hydrogen ion transporting ATPase activity, rotational mechanism; transmembrane transporter activity; transporter activity. Biological Process: ATP biosynthetic process; ATP synthesis coupled proton transport; cellular metabolic process; mitochondrial ATP synthesis coupled proton transport; oxidative phosphorylation; response to copper ion

size1 :

0.05 mg (Yeast)

price1 :

190 USD

size2 :

0.05 mg (E-Coli)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage