Recombinant Mouse Guanine nucleotide-binding protein G(o) subunit alpha | MyBioSource MBS948022 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Guanine nucleotide-binding protein G(o) subunit alpha

catalog :

MBS948022

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS948022

products type :

Recombinant Protein

products full name :

Recombinant Mouse Guanine nucleotide-binding protein G(o) subunit alpha

products short name :

Guanine nucleotide-binding protein G(o) subunit alpha

other names :

guanine nucleotide-binding protein G(o) subunit alpha isoform B; Guanine nucleotide-binding protein G(o) subunit alpha; guanine nucleotide-binding protein G(o) subunit alpha; guanine nucleotide binding protein, alpha O

products gene name :

Gnao1

other gene names :

Gnao1; Gnao1; Gnao; alphaO; Galphao; AW050213; Gna0; Gnao

uniprot entry name :

GNAO_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

2-354

sequence length :

354

sequence :

GCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG
AGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQ
SLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTE
PFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
DSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLH
FRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVL
HEDETTNRMHESLMLFDSICN

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Stimulated by RGS14. The G(o) protein function is not clear.

products references :

Alternative splicing produces transcripts encoding two forms of the alpha subunit of GTP-binding protein Go.Strathmann M., Wilkie T.M., Simon M.I.Proc. Natl. Acad. Sci. U.S.A. 87:6477-6481(1990) Lubec G., Klug S., Kang S.U.Submitted (APR-2007) to UniProtKB RGS14 is a novel Rap effector that preferentially regulates the GTPase activity of galphao.Traver S., Bidot C., Spassky N., Baltauss T., De Tand M.F., Thomas J.L., Zalc B., Janoueix-Lerosey I., Gunzburg J.D.Biochem. J. 350:19-29(2000) Functional characterization of Galphao signaling through G protein-regulated inducer of neurite outgrowth 1.Nakata H., Kozasa T.Mol. Pharmacol. 67:695-702(2005)

ncbi gi num :

164607137

ncbi acc num :

NP_001106855.1

ncbi gb acc num :

NM_001113384.1

uniprot acc num :

P18872

ncbi mol weight :

44kD

ncbi pathways :

Alcoholism Pathway (585577); Alcoholism Pathway (587116); Beta-catenin Independent WNT Signaling Pathway (1324769); Ca2+ Pathway (1324774); Calcium Regulation In The Cardiac Cell Pathway (198327); Chagas Disease (American Trypanosomiasis) Pathway (147810); Chagas Disease (American Trypanosomiasis) Pathway (147795); Cholinergic Synapse Pathway (217717); Circadian Entrainment Pathway (698783); Circadian Entrainment Pathway (699872)

uniprot summary :

G-alpha(o): Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear. Stimulated by RGS14. Interacts with RGS14. G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site. Belongs to the G-alpha family. G(i/o/t/z) subfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: G protein; G protein, heterotrimeric alpha G((i/o/t/z)); G protein, heterotrimeric. Cellular Component: dendrite; heterotrimeric G-protein complex; membrane; myelin sheath; neuron projection; plasma membrane; protein complex. Molecular Function: corticotropin-releasing hormone receptor 1 binding; G-protein beta/gamma-subunit binding; GTP binding; GTPase activating protein binding; GTPase activity; guanyl nucleotide binding; metabotropic serotonin receptor binding; metal ion binding; mu-type opioid receptor binding; nucleotide binding; protein binding; protein complex binding; signal transducer activity. Biological Process: aging; cellular process; dopamine receptor signaling pathway; G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cAMP nucleotide second messenger; locomotory behavior; negative regulation of calcium ion transport; positive regulation of GTPase activity; regulation of heart contraction; response to organic nitrogen; signal transduction

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (Yeast)

price5 :

750

more info or order :

MyBioSource product webpage