product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Keratin, type II cytoskeletal 6A
catalog :
MBS947881
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS947881
products type :
Recombinant Protein
products full name :
Recombinant Human Keratin, type II cytoskeletal 6A
products short name :
Keratin, type II cytoskeletal 6A
products name syn :
Cytokeratin-6A; CK-6A; Cytokeratin-6D; CK-6D; Keratin-6A; K6A; Type-II keratin Kb6; Allergen: Hom s 5
other names :
keratin, type II cytoskeletal 6C; Keratin, type II cytoskeletal 6A; keratin, type II cytoskeletal 6C; keratin 6A, type II; Cytokeratin-6A; CK-6A; Cytokeratin-6D; CK-6D; Keratin-6A; K6A; Type-II keratin Kb6; Allergen: Hom s 5
products gene name :
KRT6A
other gene names :
KRT6A; KRT6A; K6A; K6C; K6D; PC3; CK6A; CK6C; CK6D; CK-6C; CK-6E; KRT6C; KRT6D; K6A; KRT6D; CK-6A; CK-6D; K6A
uniprot entry name :
K2C6A_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-564, Full length.
sequence length :
564
sequence :
ASTSTTIRSHSSSRRGFSASSARLPGVSRSGFSSVSVSR
SRGSGGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAI
SGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGL
AGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPTIQ
RVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWT
LLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRL
DSELRGMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDV
DAAYMNKVELQAKADTLTDEINFLRALYDAELSQMQTHI
SDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEA
ESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRL
RSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGL
EDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLL
EGEECRLNGEGVGQVNISVVQSTVSSGYGGASGVGSGLG
LGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSS
TIKYTTTSSSSRKSYKH
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products categories :
Signal Transduction
products description :
Epidermis-specific type I keratin involved in wound healing. Involved in the activation of follicular keratinocytes after wounding, while it does not play a major role in keratinocyte proliferation or migration. Participates in the regulation of epithelial migration by inhibiting the activity of SRC during wound repair.
products references :
Cloning and characterization of multiple human genes and cDNAs encoding highly related type II keratin 6 isoforms.Takahashi K., Paladini R.D., Coulombe P.A.J. Biol. Chem. 270:18581-18592(1995)
ncbi gi num :
5031839
ncbi acc num :
NP_005545.1
ncbi gb acc num :
NM_005554.3
uniprot acc num :
P02538
ncbi mol weight :
64kD
ncbi summary :
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. This KRT6 gene in particular encodes the most abundant isoform. Mutations in these genes have been associated with pachyonychia congenita. In addition, peptides from the C-terminal region of the protein have antimicrobial activity against bacterial pathogens. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq, Oct 2014]
uniprot summary :
K6a: a type II cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. There are two types of cytoskeletal and microfibrillar keratin: type I (acidic; 40-55 kDa) [K9 to K20] and type II (neutral to basic; 56-70 kDa) [K1 to K8]. Both a basic and an acidic keratin are required for filament assembly. Associates with K16 and/or -17. Protein type: Cytoskeletal. Chromosomal Location of Human Ortholog: 12q13.13. Cellular Component: intermediate filament; keratin filament. Molecular Function: protein binding; structural molecule activity. Biological Process: intermediate filament cytoskeleton organization and biogenesis. Disease: Pachyonychia Congenita 3
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
990
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1170
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!