product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Fibronectin
catalog :
MBS947867
quantity :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS947867
products type :
Recombinant Protein
products full name :
Recombinant human Fibronectin
products short name :
Fibronectin
products name syn :
Recombinant human Fibronectin protein
host :
E Coli
sequence :
PIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNS
YTIKGLKPGVVYEGQLISIQQYG
purity :
0.9
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: Host tag may vary. Please inquire for specific tag information.
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Ref.36 Ref.38 Ref.42 Ref.50
products references :
[1] "Phenotypic and genetic alterations in mammary stroma: implications for tumour progression.
ncbi gi num :
553293
ncbi mol weight :
13 KD
ncbi pathways :
Focal Adhesion Pathway 83067!!Focal Adhesion Pathway 478!!MAPK Signaling Pathway 83048!!MAPK Signaling Pathway 456!!Salmonella Infection Pathway 375172!!Salmonella Infection Pathway 375149
size :
0.05 mg
price :
195 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!