product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Enteropeptidase (Tmprss15), partial
catalog :
MBS9424336
quantity :
0.01 mg
price :
230 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9424336
products type :
Recombinant Protein
products full name :
Recombinant Mouse Enteropeptidase (Tmprss15), partial
products short name :
[Enteropeptidase]
products name syn :
[Enterokinase, Serine protease 7, Transmembrane protease serine 15, Cleaved into the following 2 chains:Enteropeptidase non-catalytic heavy chain,Enteropeptidase catalytic light chain]
other names :
[enteropeptidase isoform 1; Enteropeptidase; enteropeptidase; transmembrane protease, serine 15; Enterokinase; Serine protease 7; Transmembrane protease serine 15]
products gene name :
[Tmprss15]
other gene names :
[Tmprss15; Tmprss15; Entk; Prss7; Entk; Prss7]
host :
E Coli
reactivity :
Mouse
sequence positions :
[Expression Region:830-1069aaSequence Info:Partial]
sequence :
IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDW
LVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRV
VDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICL
PEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPL
ISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGP
LMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEW
IHSFLH
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
other info1 :
Calculated MW: 43 kDa
other info2 :
Tag Info: N-terminal 6xHis-SUMO-tagged
products description :
Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.
ncbi gi num :
6679489
ncbi acc num :
NP_032967.1
ncbi gb acc num :
NM_008941.3
uniprot acc num :
P97435
ncbi summary :
This gene encodes an enzyme that proteolytically activates the pancreatic proenzyme trypsinogen, converting it into trypsin. The encoded protein is cleaved into two chains that form a heterodimer linked by a disulfide bond. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013]
uniprot summary :
PRSS7: Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases. Defects in TMPRSS15 are a cause of enterokinase deficiency (ENTKD); a life-threatening intestinal malabsorption disorder characterized by diarrhea and failure to thrive. Belongs to the peptidase S1 family. Protein type: EC 3.4.21.9; Membrane protein, integral; Protease. Chromosomal Location of Human Ortholog: 16 16 C3.1-C3.2
size1 :
0.01 mg
price1 :
230 USD
size2 :
0.05 mg
price2 :
290
size3 :
0.1 mg
price3 :
455
size4 :
0.2 mg
price4 :
710
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!