product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Melanoma-associated antigen 1 (MAGEA1)
catalog :
MBS9424235
quantity :
0.02 mg
price :
450 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9424235
products type :
Recombinant Protein
products full name :
Recombinant Human Melanoma-associated antigen 1 (MAGEA1)
products short name :
[Melanoma-associated antigen 1 (MAGEA1)]
products name syn :
[Antigen MZ2-E]
other names :
[melanoma-associated antigen 1; Melanoma-associated antigen 1; melanoma-associated antigen 1; MAGE family member A1; Antigen MZ2-E; Cancer/testis antigen 1.1; CT1.1; MAGE-1 antigen]
products gene name :
[MAGEA1]
other gene names :
[MAGEA1; MAGEA1; CT1.1; MAGE1; MAGE1; MAGE1A; CT1.1]
host :
Mammalian Cell
reactivity :
Human
sequence positions :
[Full Length, 1-309aa]
sequence :
SLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVL
GTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEG
SSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYR
AREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGI
DVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLI
IVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEP
RKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAET
SYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
other info2 :
Tag Info: C-terminal Flag-tagged
products description :
May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
ncbi gi num :
148276977
ncbi acc num :
NP_004979.3
ncbi gb acc num :
NM_004988.4
uniprot acc num :
P43355
ncbi mol weight :
55.19 kDa by SDS-PAGE
ncbi pathways :
Delta-Notch Signaling Pathway (198879)
ncbi summary :
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq, Jul 2008]
uniprot summary :
MAGE-A1: a tumor antigen expressed in a variety of tumor cells and in the testis. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. Protein type: Cell surface. Chromosomal Location of Human Ortholog: Xq28. Cellular Component: cytoplasm; nucleus; plasma membrane. Molecular Function: histone deacetylase binding; protein binding. Biological Process: negative regulation of Notch signaling pathway; negative regulation of transcription from RNA polymerase II promoter
size1 :
0.02 mg
price1 :
450 USD
size2 :
0.05 mg
price2 :
835
size3 :
0.1 mg
price3 :
1135
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!