Recombinant Human Pyridoxal phosphate phosphatase (PDXP) | MyBioSource MBS9424162 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Pyridoxal phosphate phosphatase (PDXP)

catalog :

MBS9424162

quantity :

0.01 mg

price :

255 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS9424162

products type :

Recombinant Protein

products full name :

Recombinant Human Pyridoxal phosphate phosphatase (PDXP)

products short name :

[Pyridoxal phosphate phosphatase (PDXP)]

other names :

[pyridoxal phosphate phosphatase; Pyridoxal phosphate phosphatase; pyridoxal phosphate phosphatase; pyridoxal phosphatase; Chronophin]

products gene name :

[PDXP]

other gene names :

[PDXP; PDXP; CIN; PLP; dJ37E16.5; CIN; PLP; PLPP; PLP phosphatase]

host :

Yeast

reactivity :

Human

sequence positions :

[Full Length, 1-296aa]

sequence :

MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPG
APELLERLARAGKAALFVSNNSRRARPELALRFARLGFG
GLRAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEG
LRAELRAAGLRLAGDPSAGDGAAPRVRAVLVGYDEHFSF
AKLREACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGS
LAAAVETASGRQALVVGKPSPYMFECITENFSIDPARTL
MVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAA
GQHDLVPHYYVESIADLTEGLED

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Tris-based buffer, 50% glycerol

storage stability :

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.

image1 heading :

SDS-PAGE

other info1 :

Target Name: PDXP

other info2 :

Tag Info: N-terminal 6xHis-tagged

products description :

Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine. Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PMP) and pyridoxine 5'-phosphate (PNP), with a highest activity with PLP followed by PNP.

ncbi gi num :

10092677

ncbi acc num :

NP_064711.1

ncbi gb acc num :

NM_020315.4

uniprot acc num :

Q96GD0

ncbi mol weight :

33.7 kDa

ncbi summary :

Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]).[supplied by OMIM, Mar 2008]

uniprot summary :

PDXP: Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho- tyrosine. Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PMP) and pyridoxine 5'-phosphate (PNP), with a highest activity with PLP followed by PNP. Homodimer. Ubiquitous. Highly expressed in all the regions of central nerve system except the spinal cord. Also expressed at high level in liver and testis. In fetus, it is weakly expressed in all organs except brain. Inhibited by NaF, Zn(2+), Ca(2+), Mn(2+) and EDTA. Belongs to the HAD-like hydrolase superfamily. Protein type: Cell cycle regulation; Cofactor and Vitamin Metabolism - vitamin B6; EC 3.1.3.3; EC 3.1.3.74; Protein phosphatase, Ser/Thr (non-receptor). Chromosomal Location of Human Ortholog: 22q13.1. Cellular Component: actin cytoskeleton; cleavage furrow; cytosol; lamellipodium; midbody; plasma membrane. Molecular Function: heat shock protein binding; magnesium ion binding; phosphoprotein phosphatase activity; protein binding; pyridoxal phosphatase activity. Biological Process: actin rod formation; positive regulation of actin filament depolymerization; protein amino acid dephosphorylation; pyridoxal phosphate catabolic process; regulation of cytokinesis; regulation of mitosis

size1 :

0.01 mg

price1 :

255 USD

size2 :

0.05 mg

price2 :

335

size3 :

0.1 mg

price3 :

535

size4 :

0.2 mg

price4 :

840

size5 :

0.5 mg

price5 :

1365

size6 :

1 mg

price6 :

2140

more info or order :

MyBioSource product webpage