catalog number :
MBS9424039
products type :
Recombinant Protein
products full name :
Recombinant Mouse 78 kDa glucose-regulated protein (Hspa5)
products short name :
[78 kDa glucose-regulated]
other names :
[78 kDa glucose-regulated protein; 78 kDa glucose-regulated protein; 78 kDa glucose-regulated protein; heat shock protein 5; Heat shock 70 kDa protein 5; Immunoglobulin heavy chain-binding protein; BiP]
products gene name :
[Hspa5]
other gene names :
[Hspa5; Hspa5; Bip; Sez7; mBiP; Grp78; SEZ-7; Hsce70; baffled; AL022860; AU019543; D2Wsu17e; D2Wsu141e; Grp78; GRP-78; BiP]
sequence positions :
[Full Length, 20-655aa]
sequence :
EEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQ
GNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAK
RLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGG
QTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPA
YFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDK
REGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTH
LGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRRE
VEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEEL
NMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP
KIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD
QDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKK
SQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTG
IPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKIT
ITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNE
LESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIE
WLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGGPPP
TGEEDTSEKDEL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
other info1 :
Calculated MW: 72.5 kDa
other info2 :
Tag Info: N-terminal 6xHis-tagged
products description :
Probably plays a role in facilitating the assembly of multimeric protein complexes inside the endoplasmic reticulum. Involved in the correct folding of proteins and degradation of misfolded proteins via its interaction with DNAJC10, probably to facilitate the release of DNAJC10 from its substrate (By similarity).
ncbi acc num :
NP_001156906.1
ncbi gb acc num :
NM_001163434.1
ncbi pathways :
Antigen Processing And Presentation Pathway (83271); Antigen Processing And Presentation Pathway (485); Hemostasis Pathway (1368135); MAPK Signaling Pathway (198294); Platelet Activation, Signaling And Aggregation Pathway (1368145); Platelet Degranulation Pathway (1368157); Prion Diseases Pathway (101157); Prion Diseases Pathway (100065); Protein Export Pathway (83238); Protein Export Pathway (446)
uniprot summary :
GRP78: a member of the HSP family of molecular chaperones required for endoplasmic reticulum integrity and stress-induced autophagy. Plays a central role in regulating the unfolded protein response (UPR), and is an obligatory component of autophagy in mammalian cells. May play an important role in cellular adaptation and oncogenic survival. One of the client proteins of GRP78 is protein double-stranded RNA-activated protein-like endoplasmic reticulum kinase (PERK). Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER. Protein type: Chaperone; Heat shock protein. Chromosomal Location of Human Ortholog: 2 B 2 22.94 cM. Cellular Component: cell surface; cytoplasm; endoplasmic reticulum; endoplasmic reticulum lumen; endoplasmic reticulum membrane; ER-Golgi intermediate compartment; extracellular matrix; focal adhesion; integral to endoplasmic reticulum membrane; membrane; midbody; mitochondrion; myelin sheath; nucleus; plasma membrane; protein complex; signalosome; smooth endoplasmic reticulum. Molecular Function: ATPase activity; cadherin binding; enzyme binding; glycoprotein binding; misfolded protein binding; protein binding; protein domain specific binding; ribosome binding; ubiquitin protein ligase binding; unfolded protein binding. Biological Process: cellular response to glucose starvation; cerebellar Purkinje cell layer development; cerebellum structural organization; ER overload response; negative regulation of apoptosis; negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of cell migration; positive regulation of embryonic development; positive regulation of protein ubiquitination; proteolysis involved in cellular protein catabolic process; unfolded protein response, activation of signaling protein activity