product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Escherichia coli Large-conductance mechanosensitive channel(mscL)
catalog :
MBS9424026
quantity :
0.01 mg
price :
200 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9424026
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli Large-conductance mechanosensitive channel(mscL)
products short name :
[Large-conductance mechanosensitive channel (mscL)]
other names :
[large-conductance mechanosensitive channel; Large-conductance mechanosensitive channel]
products gene name :
[mscL]
other gene names :
[mscL]
host :
E Coli
sequence positions :
[Full Length,1-136aa]
sequence :
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVAD
IIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVF
IQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTK
EEVLLTEIRDLLKEQNNRS
purity :
Greater than 85% as determined by SDS-PAGE.
form :
Tris-based buffer,50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
other info1 :
Immunogen Description: Greater than 85% as determined by SDS-PAGE. Target Name: mscL. Target Species: Escherichia coli O157:H7
other info2 :
Tag Info: N-terminal 6xHis-B2M-tagged
products description :
Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell (By similarity).
ncbi gi num :
15833410
ncbi acc num :
NP_312183.1
ncbi gb acc num :
NC_002695.1
uniprot acc num :
P0A743
ncbi mol weight :
30.95kDa
uniprot summary :
Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell ().
size1 :
0.01 mg
price1 :
200 USD
size2 :
0.05 mg
price2 :
380
size3 :
0.1 mg
price3 :
610
size4 :
0.2 mg
price4 :
960
size5 :
0.5 mg
price5 :
1570
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!