product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
catalog :
MBS9424018
quantity :
0.01 mg
price :
290 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS9424018 image 1
product information
catalog number :
MBS9424018
products type :
Recombinant Protein
products full name :
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
products short name :
[Snaclec rhodocytin subunit beta]
products name syn :
[Aggretin beta chain, Rhodoaggretin subunit beta]
other names :
[Snaclec rhodocytin subunit beta; Snaclec rhodocytin subunit beta; Aggretin beta chain; Rhodoaggretin subunit beta]
host :
Yeast
sequence positions :
[Full Length, 24-146aa]
sequence :
DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHL
VSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQ
WSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSF
VCKFKA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
image1 heading :
Testing Data
other info2 :
Tag Info: N-terminal 6xHis-tagged
products description :
Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B,CLEC2). Binding leads to tyrosine phosphorylation in the Cytoplasmic domain tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2,beta-1 (ITGA2,ITGB1) may also induce aggregation, but this is controversial.
ncbi gi num :
82174507
ncbi acc num :
Q9I840.1
uniprot acc num :
Q9I840
ncbi mol weight :
16.4 kDa
uniprot summary :
Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.
size1 :
0.01 mg
price1 :
290 USD
size2 :
0.05 mg
price2 :
385
size3 :
0.1 mg
price3 :
620
size4 :
0.2 mg
price4 :
990
size5 :
0.5 mg
price5 :
1365
size6 :
1 mg
price6 :
2140
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!