product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha
catalog :
MBS9424016
quantity :
0.01 mg
price :
290 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS9424016 image 1
product information
catalog number :
MBS9424016
products type :
Recombinant Protein
products full name :
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha
products short name :
[Snaclec rhodocytin subunit alpha]
products name syn :
[Aggretin alpha chain, Rhodoaggretin subunit alpha]
other names :
[Snaclec rhodocytin subunit alpha; Snaclec rhodocytin subunit alpha; Aggretin alpha chain; Rhodoaggretin subunit alpha]
host :
Yeast
reactivity :
Calloselasma rhodostoma
sequence positions :
[Full Length, 1-136aa]
sequence :
GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENG
AHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQN
KEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRK
WVNYYCEQMHAFVCKLLPY
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
image1 heading :
Testing Data (TD)
other info1 :
Immunogen Description: Expression Region: 1-136 aa Sequence Info: Full length. Calculated MW: 17.8 kDa
other info2 :
Tag Info: N-terminal 6xHis-tagged
products description :
Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the Cytoplasmic domain tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.
ncbi gi num :
82174508
ncbi acc num :
Q9I841.1
uniprot acc num :
Q9I841
uniprot summary :
Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.
size1 :
0.01 mg
price1 :
290 USD
size2 :
0.05 mg
price2 :
385
size3 :
0.1 mg
price3 :
620
size4 :
0.2 mg
price4 :
990
size5 :
0.5 mg
price5 :
1365
size6 :
1 mg
price6 :
2140
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!