product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Influenza A virus Nucleoprotein (NP)
catalog :
MBS9423735
quantity :
0.01 mg
price :
265 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS9423735 image 1
product information
catalog number :
MBS9423735
products type :
Recombinant Protein
products full name :
Recombinant Influenza A virus Nucleoprotein (NP)
products short name :
[Influenza A virus Nucleoprotein (NP)]
other names :
[nucleoprotein; Nucleoprotein; nucleoprotein; Nucleocapsid protein]
products gene name :
[NP]
other gene names :
[NP; NP; Protein N]
host :
E Coli
sequence positions :
[Full Length, 1-498aa]
sequence :
RRNKYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLND ATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELVRMIKRGINDRNFWRGENGRKT RIAYERMCNILKGKFQTAAQKAMMDQVRESRNPGNAEFEDLTFLARSALILRGSVAHKSCLPACVYGPAVASG YDFEREGYSLVGIDPFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRVLSFIKGTKVLPRGKLSTR GVQIASNENMETMESSTLELRSRYWAIRTRSGGNTNQQRASAGQISIQPTFSVQRNLPFDRTTIMAAFNGNTE GRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKAASPIVPSFDMSNEGSYFFGDNAEEYDN
MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRF
YIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDE
purity :
Greater than 80% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Tag Info: N-terminal 6xHis-B2M-tagged. Target Species: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)
ncbi gi num :
8486130
ncbi acc num :
NP_040982.1
ncbi gb acc num :
NC_002019.1
uniprot acc num :
P03466
ncbi mol weight :
56.2kD
ncbi pathways :
Assembly Of Viral Components At The Budding Site Pathway (1269125); Budding Pathway (1269128); Disease Pathway (1268854); Entry Of Influenza Virion Into Host Cell Via Endocytosis Pathway (1269110); Export Of Viral Ribonucleoproteins From Nucleus Pathway (1269121); Fusion And Uncoating Of The Influenza Virion Pathway (1269111); Fusion Of The Influenza Virion To The Host Cell Endosome Pathway (1269112); Infectious Disease Pathway (1269056); Influenza A Virus Infection Pathway (920973); Influenza Infection Pathway (1269108)
uniprot summary :
Encapsidates the negative strand viral RNA, protecting it from nucleases. The encapsidated genomic RNA is termed the ribonucleoprotein (RNP) and serves as template for transcription and replication. The RNP needs to be localized in the host nucleus to start an infectious cycle, but is too large to diffuse through the nuclear pore complex. NP comprises at least 2 nuclear localization signals that are responsible for the active RNP import into the nucleus through cellular importin alpha/beta pathway. Later in the infection, nclear export of RNPs are mediated through viral proteins NEP interacting with M1 which binds nucleoproteins. It is possible that nucleoprotein binds directly host exportin-1/XPO1 and plays an active role in RNPs nuclear export. M1 interaction with RNP seems to hide nucleoprotein's nuclear localization signals. Soon after a virion infects a new cell, M1 dissociates from the RNP under acidification of the virion driven by M2 protein. Dissociation of M1 from RNP unmasks nucleoprotein's nuclear localization signals, targeting the RNP to the nucleus.
size1 :
0.01 mg
price1 :
265 USD
size2 :
0.05 mg
price2 :
350
size3 :
0.1 mg
price3 :
560
size4 :
0.2 mg
price4 :
880
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!