Recombinant Rat Complement C3 (C3), partial | MyBioSource MBS9423724 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Rat Complement C3 (C3), partial

catalog :

MBS9423724

quantity :

0.01 mg

price :

230 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS9423724

products type :

Recombinant Protein

products full name :

Recombinant Rat Complement C3 (C3), partial

products short name :

[Complement C3 (C3)]

products name syn :

[Neutrophil chemotactic factor-2]

other names :

[complement C3; Complement C3; complement C3; complement C3; Complement C3 beta chainC3-beta-c; C3bc]

products gene name :

[C3]

other gene names :

[C3; C3; C3bc; ENCF-2; ENCF-1; ASP]

host :

Yeast

reactivity :

Rat

sequence positions :

[Partial, 671-746aa]

sequence :

SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQR
RARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Tris-based buffer, 50% glycerol

storage stability :

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

image1 heading :

SDS-PAGE

other info1 :

Brief Description: Recombinant Protein.

other info2 :

Tag Info: N-terminal 6xHis-tagged

products description :

C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.

ncbi gi num :

158138561

ncbi acc num :

NP_058690.2

ncbi gb acc num :

NM_016994.2

uniprot acc num :

P01026

ncbi mol weight :

11 kDa

ncbi pathways :

Activation Of C3 And C5 Pathway (1377188); Adaptive Immune System Pathway (1377120); Alternative Complement Activation Pathway (1377187); Chagas Disease (American Trypanosomiasis) Pathway (147806); Chagas Disease (American Trypanosomiasis) Pathway (147795); Class A/1 (Rhodopsin-like Receptors) Pathway (1376996); Complement Activation, Classical Pathway (198509); Complement And Coagulation Cascades Pathway (198461); Complement And Coagulation Cascades Pathway (83465); Complement And Coagulation Cascades Pathway (484)

ncbi summary :

putative complement component C3; likely involved in innate immune response [RGD, Feb 2006]

uniprot summary :

C3: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Defects in C3 are the cause of complement component 3 deficiency (C3D). A rare defect of the complement classical pathway. Patients develop recurrent, severe, pyogenic infections because of ineffective opsonization of pathogens. Some patients may also develop autoimmune disorders, such as arthralgia and vasculitic rashes, lupus-like syndrome and membranoproliferative glomerulonephritis. Genetic variation in C3 is associated with susceptibility to age-related macular degeneration type 9 (ARMD9). ARMD is a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin- containing structure known as Bruch membrane. Defects in C3 are a cause of susceptibility to hemolytic uremic syndrome atypical type 5 (AHUS5). An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype. Increased levels of C3 and its cleavage product ASP, are associated with obesity, diabetes and coronary heart disease. Short-term endurance training reduces baseline ASP levels and subsequently fat storage. Protein type: Inhibitor; Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 9q12. Cellular Component: extracellular space. Molecular Function: C5L2 anaphylatoxin chemotactic receptor binding; cofactor binding; lipid binding; protein binding. Biological Process: blood coagulation; complement activation; complement activation, classical pathway; positive regulation of activation of membrane attack complex; positive regulation of angiogenesis; positive regulation of developmental growth; positive regulation of G-protein coupled receptor protein signaling pathway; positive regulation of phagocytosis; positive regulation of protein amino acid phosphorylation; positive regulation of type IIa hypersensitivity; response to estradiol stimulus; response to estrogen stimulus; response to glucocorticoid stimulus; response to magnesium ion; response to progesterone stimulus; tolerance induction

size1 :

0.01 mg

price1 :

230 USD

size2 :

0.05 mg

price2 :

290

size3 :

0.1 mg

price3 :

455

size4 :

0.2 mg

price4 :

705

size5 :

0.5 mg

price5 :

1145

size6 :

1 mg

price6 :

1800

more info or order :

MyBioSource product webpage