product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Cyclic GMP-AMP synthase (MB21D1), partial
catalog :
MBS9423611
quantity :
0.01 mg
price :
180 USD
more info or order :
product information
catalog number :
MBS9423611
products type :
Recombinant Protein
products full name :
Recombinant Human Cyclic GMP-AMP synthase (MB21D1), partial
products short name :
[Cyclic GMP-AMP synthase (MB21D1)]
products name syn :
[cGAMP synthase]
other names :
[cyclic GMP-AMP synthase; Cyclic GMP-AMP synthase; cyclic GMP-AMP synthase; Mab-21 domain containing 1; 2'3'-cGAMP synthase; Mab-21 domain-containing protein 1]
products gene name :
[MB21D1]
other gene names :
[MB21D1; MB21D1; cGAS; h-cGAS; C6orf150; C6orf150; cGAMP synthase; cGAS; h-cGAS]
host :
E Coli
reactivity :
Human
sequence positions :
[Partial, 161-522aa]
sequence :
GASKLRAVLEKLKLSRDDISTAAGMVKGVVDHLLLRLKC
DSAFRGVGLLNTGSYYEHVKISAPNEFDVMFKLEVPRIQ
LEEYSNTRAYYFVKFKRNPKENPLSQFLEGEILSASKML
SKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKI
SVDITLALESKSSWPASTQEGLRIQNWLSAKVRKQLRLK
PFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSK
TCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKF
SSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFL
QCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYE
RNNEFPVFDEF
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20 °C/-80°C. Notes: Repeated freezing and thawing is not recommended.Store working aliquots at 4°C for up to one week.
other info1 :
Calculated MW: 58.3 kDa. Immunogen Description: Expression Region:161-522aaSequence Info:Partial
other info2 :
Tag Info: N-terminal 6xHis-SUMO-tagged
products description :
Nucleotidyltransferase that catalyzes the formation of cyclic GMP-AMP (cGAMP) from ATP and GTP. Catalysis involves both the formation of a 2', 5' phosphodiester linkage at the GpA step and the formation of a 3', 5' phosphodiester linkage at the ApG step, producing c[G (2', 5')pA (3', 5')p]. Has antiviral activity by acting as a key cytosolic DNA sensor, the presence of double-stranded DNA (dsDNA) in the cytoplasm being a danger signal that triggers the immune responses. Binds cytosolic DNA directly, leading to activation and synthesis of cGAMP, a second messenger that binds to and activates TMEM173/STING, thereby triggering type-I interferon production. cGAMP can be transferred between cells by virtue of packaging within viral particles contributing to IFN-induction in newly infected cells in a cGAS-independent but TMEM173/STING-dependent manner (PubMed:26229115).
ncbi gi num :
115511030
ncbi acc num :
NP_612450.2
ncbi gb acc num :
NM_138441.2
uniprot acc num :
Q8N884
ncbi pathways :
Cytosolic DNA-sensing Pathway (125137); Cytosolic DNA-sensing Pathway (124833); Cytosolic Sensors Of Pathogen-associated DNA Pathway (1269268); Immune System Pathway (1269170); Innate Immune System Pathway (1269203); STING Mediated Induction Of Host Immune Responses Pathway (1269272)
uniprot summary :
cGAS: Nucleotidyltransferase that catalyzes the formation of cyclic GMP-AMP (cGAMP) from ATP and GTP. Catalysis involves both the formation of a 2',5' phosphodiester linkage at the GpA step and the formation of a 3',5' phosphodiester linkage at the ApG step, producing c[G(2',5')pA(3',5')p]. Has antiviral activity by acting as a key cytosolic DNA sensor, the presence of double-stranded DNA (dsDNA) in the cytoplasm being a danger signal that triggers the immune responses. Binds cytosolic DNA directly, leading to activation and synthesis of cGAMP, a second messenger that binds to and activates TMEM173/STING, thereby triggering type-I interferon production. Protein type: EC 2.7.7.86. Chromosomal Location of Human Ortholog: 6q13. Cellular Component: cytosol. Molecular Function: DNA binding; double-stranded DNA binding. Biological Process: activation of innate immune response; cyclic nucleotide biosynthetic process; defense response to virus; positive regulation of defense response to virus by host; positive regulation of interferon type I production
size1 :
0.01 mg
price1 :
180 USD
size2 :
0.05 mg
price2 :
225
size3 :
0.1 mg
price3 :
320
size4 :
0.2 mg
price4 :
500
size5 :
0.5 mg
price5 :
800
size6 :
1 mg
price6 :
1235
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!