product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1)
catalog :
MBS9423592
quantity :
0.01 mg
price :
265 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS9423592 image 1
product information
catalog number :
MBS9423592
products type :
Recombinant Protein
products full name :
Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1)
products short name :
[Nicotinamidase]
products name syn :
[Nicotine deamidase]
other names :
[nicotinamidase; Nicotinamidase; nicotinamidase; Nicotinamide deamidase; NAMase]
products gene name :
[PNC1]
other gene names :
[PNC1; PNC1; NAMase]
host :
E Coli
reactivity :
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
image2 heading :
Testing Data TD
other info1 :
PRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHH TDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDA
DRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHS
. Target Sequence:
other info2 :
. SDS-PAGE MW: 27.86kDa. Tag Info: N-terminal 6xHis-tagged. Target Lenght: Full Length,1-216aa
products description :
Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.
ncbi gi num :
398364807
ncbi acc num :
NP_011478.3
ncbi gb acc num :
NM_001180902.3
uniprot acc num :
P53184
ncbi pathways :
Metabolic Pathways (131993); NAD Salvage Pathway (198755); NAD Salvage Pathway (143530); NAD Salvage Pathway I (138372); Nicotinate And Nicotinamide Metabolism Pathway (929); Nicotinate And Nicotinamide Metabolism Pathway (400); Superpathway Of NAD Biosynthesis In Eukaryotes (138369)
uniprot summary :
Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.
size1 :
0.01 mg
price1 :
265 USD
size2 :
0.05 mg
price2 :
350
size3 :
0.1 mg
price3 :
560
size4 :
0.2 mg
price4 :
880
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!