protein

Recombinant Human Fibrinogen beta chain (FGB)

MBS9423552

0.01 mg

180 USD

Recombinant Protein

Recombinant Human Fibrinogen beta chain (FGB)

[Fibrinogen beta chain (FGB)]

[fibrinogen beta chain isoform 2 preproprotein; Fibrinogen beta chain; fibrinogen beta chain; fibrinogen beta chain]

[FGB]

[FGB; FGB; HEL-S-78p]

E Coli

Human

[Full Length, 45-491aa]

LQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVN SNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSV KPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLT RMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMF FSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNW KGSWYSMRKMSMKIRPFFPQQ
GHRPLDKKREEAPSLRPAPPPISGGGYRARPAKAAATQK
KVERKAPDAGGCLHADPDLGVLCPTGCQLQEAL

Greater than 90% as determined by SDS-PAGE.

Tris-based buffer, 50% glycerol

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Testing Data (TD)

Calculated MW: 54.8 kDa. Immunogen Description: Expression Region:45-491aa; Sequence Info:Partial

Tag Info: N-terminal 6xHis-tagged

Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways.

296080754

NP_001171670.1

NM_001184741.1

P02675

Blood Clotting Cascade Pathway (198840); Common Pathway (106060); Complement And Coagulation Cascades Pathway (198880); Complement And Coagulation Cascades Pathway (83073); Complement And Coagulation Cascades Pathway (484); Formation Of Fibrin Clot (Clotting Cascade) Pathway (106057); GRB2:SOS Provides Linkage To MAPK Signaling For Intergrins Pathway (106055); Hemostasis Pathway (106028); Integrin AlphaIIb Beta3 Signaling Pathway (106054); Integrin Cell Surface Interactions Pathway (106110)

The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]

FGB: Fibrinogen has a double function: yielding monomers that polymerize into fibrin and acting as a cofactor in platelet aggregation. Defects in FGB are a cause of congenital afibrinogenemia (CAFBN). This rare autosomal recessive disorder is characterized by bleeding that varies from mild to severe and by complete absence or extremely low levels of plasma and platelet fibrinogen. Patients with congenital fibrinogen abnormalities can manifest different clinical pictures. Some cases are clinically silent, some show a tendency toward bleeding and some show a predisposition for thrombosis with or without bleeding. Protein type: Adaptor/scaffold; Cell surface; Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 4q31.3. Cellular Component: cell surface; external side of plasma membrane; extracellular region; extracellular space; fibrinogen complex; plasma membrane. Molecular Function: cell adhesion molecule binding; chaperone binding; protein binding; receptor binding; structural molecule activity. Biological Process: blood coagulation; cell-matrix adhesion; cellular protein complex assembly; extracellular matrix organization and biogenesis; fibrinolysis; induction of bacterial agglutination; plasminogen activation; platelet degranulation; positive regulation of exocytosis; positive regulation of heterotypic cell-cell adhesion; positive regulation of protein secretion; positive regulation of vasoconstriction; protein polymerization; response to calcium ion; toll-like receptor signaling pathway. Disease: Afibrinogenemia, Congenital; Dysfibrinogenemia, Congenital

0.01 mg

180 USD

0.05 mg

225

0.1 mg

320

0.2 mg

500

0.5 mg

800

1 mg

1235