product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Androctonus australis Alpha-mammal toxin AaH2
catalog :
MBS9423470
quantity :
0.01 mg
price :
265 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS9423470 image 1
product information
catalog number :
MBS9423470
products type :
Recombinant Protein
products full name :
Recombinant Androctonus australis Alpha-mammal toxin AaH2
products short name :
[Alpha-mammal toxin AaH2]
products name syn :
[AaH II]
other names :
[Alpha-mammal toxin AaH2; Alpha-mammal toxin AaH2; AaH II; AaHII; Neurotoxin 2]
other gene names :
[AaHII; AaHII]
host :
E Coli
reactivity :
Sahara scorpion
sequence positions :
[Full Length, 20-83aa]
sequence :
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWA
SPYGNACYCYKLPDHVRTKGPGRCH
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Tag Info: N-terminal 6xHis-SUMO-tagged
products description :
Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against mammals.
ncbi gi num :
401071
ncbi acc num :
P01484.3
uniprot acc num :
P01484
ncbi mol weight :
23.25 kDa
uniprot summary :
Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against mammals.MiscellaneousEC(50) is 2.6 nM on rat brain Nav1.2 (SCN2A) sodium channel. EC(50) is 2.2 nM on rat skeletal muscle Nav1.4 (SCN4A) sodium channel.The chimeric protein obtained (PubMed:15133045) with the three mutants 27-Asp--Val-29, Gly-36 and 75-Arg--Arg-81 is termed chimera Aah2/Lqh-alpha-IT(27-29,36,75-81). This chimera was constructed so as to test the importance of critical residues of Lqh-alpha-IT.
size1 :
0.01 mg
price1 :
265 USD
size2 :
0.05 mg
price2 :
350
size3 :
0.1 mg
price3 :
560
size4 :
0.2 mg
price4 :
880
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!