catalog number :
MBS9423437
products type :
Recombinant Protein
products full name :
Recombinant Human Vesicle-associated membrane protein 2 (VAMP2)
products short name :
[Vesicle-associated membrane protein 2 (VAMP2)]
products name syn :
[Synaptobrevin-2]
other names :
[vesicle-associated membrane protein 2 isoform 1; Vesicle-associated membrane protein 2; vesicle-associated membrane protein 2; vesicle associated membrane protein 2; Synaptobrevin-2]
products gene name :
[VAMP2]
other gene names :
[VAMP2; VAMP2; SYB2; VAMP-2; SYB2; VAMP-2]
sequence positions :
[Full Length, 1-116aa]
sequence :
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQV
DEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFE
TSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to man factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C to -80°C. The shelf life of lyophilized form is 12 months at -20°C to -80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
image1 heading :
SDS-PAGE
other info1 :
Calculated MW: 39.7 kDa
other info2 :
Tag Info: N-terminal GST-tagged
products description :
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
ncbi acc num :
NP_055047.2
ncbi gb acc num :
NM_014232.2
ncbi pathways :
Acetylcholine Neurotransmitter Release Cycle Pathway (106525); Clathrin Derived Vesicle Budding Pathway (119545); Disease Pathway (530764); Dopamine Neurotransmitter Release Cycle Pathway (106523); Effects Of Botulinum Toxin Pathway (138028); GABA Synthesis, Release, Reuptake And Degradation Pathway (187174); Glutamate Neurotransmitter Release Cycle Pathway (106522); Golgi Associated Vesicle Biogenesis Pathway (119546); Insulin Signaling Pathway (198845); Insulin Processing Pathway (105903)
ncbi summary :
The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis of FIMG. [provided by RefSeq, Jul 2008]
uniprot summary :
VAMP2: a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. Thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Vesicle. Chromosomal Location of Human Ortholog: 17p13.1. Cellular Component: clathrin coated vesicle membrane; clathrin-coated vesicle; cytoplasmic vesicle; cytosol; integral to plasma membrane; intracellular membrane-bound organelle; membrane; neuron projection; perinuclear region of cytoplasm; plasma membrane; secretory granule; secretory granule membrane; SNARE complex; synapse; synaptic vesicle; synaptic vesicle membrane; trans-Golgi network; vesicle; voltage-gated potassium channel complex; zymogen granule membrane. Molecular Function: calcium-dependent protein binding; calmodulin binding; phospholipid binding; protein binding; protein self-association; SNAP receptor activity; SNARE binding; syntaxin binding; syntaxin-1 binding. Biological Process: calcium ion-dependent exocytosis; cellular response to insulin stimulus; eosinophil degranulation; exocytosis; glutamate secretion; Golgi to plasma membrane protein transport; natural killer cell degranulation; neurotransmitter secretion; neutrophil degranulation; post-Golgi vesicle-mediated transport; protein complex assembly; protein transport; regulation of exocytosis; response to glucose stimulus; synaptic vesicle exocytosis; vesicle fusion; vesicle-mediated transport