Recombinant Human Vesicle-associated membrane protein 2 (VAMP2) | MyBioSource MBS9423437 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Vesicle-associated membrane protein 2 (VAMP2)

catalog :

MBS9423437

quantity :

0.01 mg

price :

180 USD

more info or order :

MyBioSource product webpage

image

image 1 :

Greather than 90% as determined by SDS-PAGE

product information

catalog number :

MBS9423437

products type :

Recombinant Protein

products full name :

Recombinant Human Vesicle-associated membrane protein 2 (VAMP2)

products short name :

[Vesicle-associated membrane protein 2 (VAMP2)]

products name syn :

[Synaptobrevin-2]

other names :

[vesicle-associated membrane protein 2 isoform 1; Vesicle-associated membrane protein 2; vesicle-associated membrane protein 2; vesicle associated membrane protein 2; Synaptobrevin-2]

products gene name :

[VAMP2]

other gene names :

[VAMP2; VAMP2; SYB2; VAMP-2; SYB2; VAMP-2]

host :

E Coli

reactivity :

Human

sequence positions :

[Full Length, 1-116aa]

sequence :

MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQV
DEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFE
TSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Tris-based buffer, 50% glycerol

storage stability :

The shelf life is related to man factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C to -80°C. The shelf life of lyophilized form is 12 months at -20°C to -80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

image1 heading :

SDS-PAGE

other info1 :

Calculated MW: 39.7 kDa

other info2 :

Tag Info: N-terminal GST-tagged

products description :

Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.

ncbi gi num :

172072620

ncbi acc num :

NP_055047.2

ncbi gb acc num :

NM_014232.2

uniprot acc num :

P63027

ncbi pathways :

Acetylcholine Neurotransmitter Release Cycle Pathway (106525); Clathrin Derived Vesicle Budding Pathway (119545); Disease Pathway (530764); Dopamine Neurotransmitter Release Cycle Pathway (106523); Effects Of Botulinum Toxin Pathway (138028); GABA Synthesis, Release, Reuptake And Degradation Pathway (187174); Glutamate Neurotransmitter Release Cycle Pathway (106522); Golgi Associated Vesicle Biogenesis Pathway (119546); Insulin Signaling Pathway (198845); Insulin Processing Pathway (105903)

ncbi summary :

The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis of FIMG. [provided by RefSeq, Jul 2008]

uniprot summary :

VAMP2: a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. Thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Vesicle. Chromosomal Location of Human Ortholog: 17p13.1. Cellular Component: clathrin coated vesicle membrane; clathrin-coated vesicle; cytoplasmic vesicle; cytosol; integral to plasma membrane; intracellular membrane-bound organelle; membrane; neuron projection; perinuclear region of cytoplasm; plasma membrane; secretory granule; secretory granule membrane; SNARE complex; synapse; synaptic vesicle; synaptic vesicle membrane; trans-Golgi network; vesicle; voltage-gated potassium channel complex; zymogen granule membrane. Molecular Function: calcium-dependent protein binding; calmodulin binding; phospholipid binding; protein binding; protein self-association; SNAP receptor activity; SNARE binding; syntaxin binding; syntaxin-1 binding. Biological Process: calcium ion-dependent exocytosis; cellular response to insulin stimulus; eosinophil degranulation; exocytosis; glutamate secretion; Golgi to plasma membrane protein transport; natural killer cell degranulation; neurotransmitter secretion; neutrophil degranulation; post-Golgi vesicle-mediated transport; protein complex assembly; protein transport; regulation of exocytosis; response to glucose stimulus; synaptic vesicle exocytosis; vesicle fusion; vesicle-mediated transport

size1 :

0.01 mg

price1 :

180 USD

size2 :

0.05 mg

price2 :

225

size3 :

0.1 mg

price3 :

320

size4 :

0.2 mg

price4 :

500

size5 :

0.5 mg

price5 :

800

size6 :

1 mg

price6 :

1235

more info or order :

MyBioSource product webpage