product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Dermatophagoides pteronyssinus Peptidase 1 (DERP1)
catalog :
MBS9423386
quantity :
0.01 mg
price :
265 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS9423386 image 1
product information
catalog number :
MBS9423386
products type :
Recombinant Protein
products full name :
Recombinant Dermatophagoides pteronyssinus Peptidase 1 (DERP1)
products short name :
[Peptidase 1 (DERP1)]
products name syn :
[Allergen Der p I, Major mite fecal allegen Der p 1, Allergen, Der p 1]
other names :
[Peptidase 1; Peptidase 1; Allergen Der p I; Major mite fecal allergen Der p 1; Allergen: Der p 1]
products gene name :
[DERP1]
other gene names :
[DERP1]
host :
E Coli
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
image1 heading :
Testing Data TD
other info1 :
Target Name: DERP1. Target Length: Full Length, 99-320aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Species: Dermatophagoides pteronyssinus (European house dust mite).
other info2 :
DTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAF RHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL
TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSG
VAATESAYLAYRNQSLDLAEQELVDCASQHGCHG
Target Sequence:
products description :
Thiol protease, with a preference for substrates with a large hydrophobic side chain in the P2 position, or with basic residues.
ncbi gi num :
730036
ncbi acc num :
P08176.2
uniprot acc num :
P08176
ncbi mol weight :
41 kDa
uniprot summary :
Thiol protease, with a preference for substrates with a large hydrophobic side chain in the P2 position, or with basic residues.
size1 :
0.01 mg
price1 :
265 USD
size2 :
0.05 mg
price2 :
350
size3 :
0.1 mg
price3 :
560
size4 :
0.2 mg
price4 :
880
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!