product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human papillomavirus type 18 Protein E7
catalog :
MBS9422684
quantity :
0.01 mg
price :
200 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9422684
products type :
Recombinant Protein
products full name :
Recombinant Human papillomavirus type 18 Protein E7
products short name :
[papillomavirus type 18 Protein E7]
other names :
[Protein E7; Protein E7]
products gene name :
[VE7]
other gene names :
[E7]
host :
Yeast
reactivity :
HPV18
sequence positions :
[Full Length, 1-105aa]
sequence :
MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEEND
EIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVES
SADDLRAFQQLFLNTLSFVCPWCASQQ
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients storage temperature and the stability of the protein itself. Generally the shelf life of liquid is 6 months at -20°C to -80°C. The shelf life of lyophilized form is 12 months at -20°C to -80°C . Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Calculated MW: 14 kDa
other info2 :
Tag Info: N-terminal 6xHis-tagged
products description :
Recombinant protein. E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassbly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription.
ncbi gi num :
137792
ncbi acc num :
P06788.2
uniprot acc num :
P06788
uniprot summary :
Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host inteferon alpha.
size1 :
0.01 mg
price1 :
200 USD
size2 :
0.05 mg
price2 :
250
size3 :
0.1 mg
price3 :
380
size4 :
0.2 mg
price4 :
590
size5 :
0.5 mg
price5 :
950
size6 :
1 mg
price6 :
1475
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!