product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rotavirus A Intermediate capsid protein VP6
catalog :
MBS9422604
quantity :
0.01 mg
price :
290 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9422604
products type :
Recombinant Protein
products full name :
Recombinant Rotavirus A Intermediate capsid protein VP6
products short name :
[Rotavirus A Intermediate capsid protein VP6]
other names :
[Intermediate capsid protein VP6; Intermediate capsid protein VP6]
products gene name :
[VP6]
host :
Yeast
sequence positions :
[Full Length, 1-397aa]
sequence :
MDVLYSLSKTLKDARDKIVEGTLYSNVSDLIQQFNQMII
TMNGNEFQTGGIGNLPIRNWNFDFGLLGTTLLNLDANYV
ETARNTIDYFVDFVDNVCMDEMVRESQRNGIAPQSDSLI
KLSGIKFKRINFDNSSEYIENWNLQNRRQRTGFTFHKPN
IFPYSASFTLNRSQPAHDNLMGTMWLNAGSEIQVAGFDY
SCAINAPANTQQFEHIVQLRRVLTTATITLLPDAERFSF
PRVITSADGATTWYFNPVILRPNNVEIEFLLNGQIINTY
QARFGTIIARNFDTIRLSFQLMRPPNMTPAVAALFPNAQ
PFEHHATVGLTLRIESAVCESVLADASETMLANVTSVRQ
EYAIPVGPVFPPGMNWTDLITNYSPSREDNLQRVFTVAS
IRSMLVK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info2 :
Calculated MW: 46.9 kDa. Tag Info: N-terminal 6xHis-tagged. immunogen Description: Expression Region:1-397aaSequence Info:Full Length
products description :
Intermediate capsid protein that self assbles to form an icosahedral capsid with a T=13 symmetry, which consists of 230 trimers of VP6, with channels at each of its five-fold vertices. This capsid constitutes the middle concentric layer of the viral mature particle. The innermost VP2 capsid and the intermediate VP6 capsid rain intact following cell entry to protect the dsRNA from degradation and to prevent unfavorable antiviral responses in the host cell during all the replication cycle of the virus. Nacent transcripts are transcribed within the structural confines of this double-layered particle (DLP) and are extruded through the channels at the five-fold axes. VP6 is required for the transcription activity of the DLP .
ncbi gi num :
139497
ncbi acc num :
P18610.1
uniprot acc num :
P04509
uniprot summary :
Intermediate capsid protein that self assembles to form an icosahedral capsid with a T=13 symmetry, which consists of 230 trimers of VP6, with channels at each of its five-fold vertices. This capsid constitutes the middle concentric layer of the viral mature particle. The innermost VP2 capsid and the intermediate VP6 capsid remain intact following cell entry to protect the dsRNA from degradation and to prevent unfavorable antiviral responses in the host cell during all the replication cycle of the virus. Nascent transcripts are transcribed within the structural confines of this double-layered particle (DLP) and are extruded through the channels at the five-fold axes. VP6 is required for the transcription activity of the DLP ().
size1 :
0.01 mg
price1 :
290 USD
size2 :
0.05 mg
price2 :
385
size3 :
0.1 mg
price3 :
620
size4 :
0.2 mg
price4 :
990
size5 :
0.5 mg
price5 :
1365
size6 :
1 mg
price6 :
2140
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!