MSGGKQHNAVSIPVNREQRSFEKQRRDLLTGLEHGGGAH
RGNSIAPYTEDWPSTVDNWIDSSWKRWDDDM

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Rotavirus A Intermediate capsid protein VP6 | MBS9422604
- Recombinant mouse Carboxylesterase 1C | MBS9422631
- Recombinant Toxocara canis 26 kDa secreted antigen | MBS9422649
- Recombinant Human papillomavirus type 18 Protein E7 | MBS9422684
- Recombinant Rat Growth-regulated alpha protein (Cxcl1) | MBS9423016