product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Epstein-Barr virus Latent membrane protein 1
catalog :
MBS9422588
quantity :
0.01 mg
price :
290 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9422588
products type :
Recombinant Protein
products full name :
Recombinant Epstein-Barr virus Latent membrane protein 1
products short name :
[Latent membrane protein 1]
products name syn :
[Protein p63]
other names :
[Latent membrane protein 1; Latent membrane protein 1; Protein p63]
products gene name :
[LMP1]
other gene names :
[LMP1; LMP-1]
host :
Yeast
reactivity :
EBVR
sequence positions :
[Full Length of Cytoplasmic Domain, 185-386aa]
sequence :
YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGR
HLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDN
GPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNG
PHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMT
DGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGP
VQLSYYD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Target Name: LMP1
other info2 :
Tag Info: His-tag
products description :
Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. It is a short-lived protein probably degraded by the proteasome.
ncbi gi num :
126375
ncbi acc num :
P13198.1
uniprot acc num :
P13198
ncbi mol weight :
22.97kD
uniprot summary :
Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses.
size1 :
0.01 mg
price1 :
290 USD
size2 :
0.05 mg
price2 :
385
size3 :
0.1 mg
price3 :
620
size4 :
0.2 mg
price4 :
990
size5 :
0.5 mg
price5 :
1365
size6 :
1 mg
price6 :
2140
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!