Recombinant Human Toll-like receptor 8 | MyBioSource MBS9422527 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Toll-like receptor 8

catalog :

MBS9422527

quantity :

0.01 mg

price :

200 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS9422527

products type :

Recombinant Protein

products full name :

Recombinant Human Toll-like receptor 8

products short name :

[Toll-like receptor 8]

products name syn :

[CD288]

other names :

[toll-like receptor 8 isoform 1; Toll-like receptor 8; toll-like receptor 8; toll like receptor 8; CD_antigen: CD288]

products gene name :

[TLR8]

other gene names :

[TLR8; TLR8; CD288]

host :

Yeast

sequence positions :

[Full Length, 27-827]

sequence :

QHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYL AWNCYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDL SGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEI ASGAFLTMLPRLEILDLSFNYIKGSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGI NFIKQIDFKLFQNFSNLEIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQC AAYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELS DLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDN RYISIFKGLKNLTRLDLSLNRLKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTD SLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIG DFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVT
EENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYV
TELDLSDNFITHITNESFQGLQNLTKINLNHNPNV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Tris-based buffer 50% glycerol.

storage stability :

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C to -80°C. The shelf life of lyophilized form is 12 months at -20°C to -80°C. Notes: Repeated freezing and thawing is not recommended . Store working aliquots at 4°C for up to one week.

other info1 :

Calculated MW: 93.5 kDa. Tag info: N-terminal 6xHis-tagged. Immunogen Description: Expression Region:27-827 Sequence Info: partial

products description :

Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

ncbi gi num :

20302166

ncbi acc num :

NP_057694.2

ncbi gb acc num :

NP_057694.2

uniprot acc num :

Q9NR97

ncbi pathways :

Immune System Pathway (106386); Innate Immune System Pathway (106387); MyD88 Dependent Cascade Initiated On Endosome Pathway (187081); Regulation Of Toll-like Receptor Signaling Pathway (920955); TRAF6 Mediated IRF7 Activation In TLR7/8 Or 9 Signaling Pathway (187085); TRAF6 Mediated Induction Of NFkB And MAP Kinases Upon TLR7/8 Or 9 Activation Pathway (187082); Toll Like Receptor 7/8 (TLR7/8) Cascade Pathway (106396); Toll Like Receptor 9 (TLR9) Cascade Pathway (106397); Toll-Like Receptors Cascades Pathway (106388); Toll-like Receptor Signaling Pathway (83076)

ncbi summary :

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung and peripheral blood leukocytes, and lies in close proximity to another family member, TLR7, on chromosome X. [provided by RefSeq, Jul 2008]

uniprot summary :

TLR8: Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Belongs to the Toll-like receptor family. Protein type: Membrane protein, integral; Receptor, misc. Chromosomal Location of Human Ortholog: Xp22.2. Cellular Component: endoplasmic reticulum membrane; endosome membrane; external side of plasma membrane; Golgi membrane; integral to membrane; integral to plasma membrane. Molecular Function: DNA binding; double-stranded RNA binding; receptor activity; RNA binding; single-stranded RNA binding. Biological Process: defense response to virus; I-kappaB kinase/NF-kappaB cascade; immunoglobulin mediated immune response; inflammatory response; positive regulation of innate immune response; positive regulation of interferon-alpha biosynthetic process; positive regulation of interferon-beta biosynthetic process; positive regulation of interferon-gamma biosynthetic process; positive regulation of interleukin-1 beta secretion; positive regulation of interleukin-8 biosynthetic process; response to virus; toll-like receptor 8 signaling pathway; toll-like receptor 9 signaling pathway; toll-like receptor signaling pathway

size1 :

0.01 mg

price1 :

200 USD

size2 :

0.05 mg

price2 :

250

size3 :

0.1 mg

price3 :

380

size4 :

0.2 mg

price4 :

590

size5 :

0.5 mg

price5 :

950

size6 :

1 mg

price6 :

1475

more info or order :

MyBioSource product webpage