catalog number :
MBS9422422
products type :
Recombinant Protein
products full name :
Recombinant Mus musculus Neurofilament light polypeptide
products short name :
[Neurofilament light polypeptide]
products name syn :
[68 kDa neurofilament protein; Neurofilament triplet L protein]
other names :
[neurofilament light polypeptide; Neurofilament light polypeptide; neurofilament light polypeptide; neurofilament, light polypeptide; 68 kDa neurofilament protein; Neurofilament triplet L protein]
products gene name :
[NFL]
other gene names :
[Nefl; Nefl; Nfl; NF-L; NF68; CMT2E; AI847934; Nf68; Nfl; NF-L]
sequence positions :
[Full Length, 2-543aa]
sequence :
SSFGYDPYFSTSYKRRYVETPRVHISSVRSGYSTARSAY
SSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAI
SNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVL
EAELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEK
QALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEAR
KGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQ
AQIQYAQISVEMDVSSKPDLSAALKDIRAQYEKLAAKNM
QNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVSESRRLL
KAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTI
NKLENELRSTKSEMARYLKEYQDLLNVKMALDIEIAAYR
KLLEGEETRLSFTSVGSITSGYSQSSQVFGRSAYSGLQS
SSYLMSARSFPAYYTSHVQEEQTEVEETIEATKAEEAKD
EPPSEGEAEEEEKEKEEGEEEEGAEEEEAAKDESEDTKE
EEEGGEGEEEDTKESEEEEKKEESAGEEQVAKKKD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Target Name: NFL. Calculated MW: 63.38 kD. Target Length: Full length-2-543
other info2 :
Tag Info: His-tag
products description :
Recombinant protein. Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber.
ncbi acc num :
NP_035040.1
ncbi gb acc num :
NM_010910.1
ncbi pathways :
ARMS-mediated Activation Pathway (1366978); Activation Of NMDA Receptor Upon Glutamate Binding And Postsynaptic Events Pathway (1368085); Amyotrophic Lateral Sclerosis (ALS) Pathway (83296); Amyotrophic Lateral Sclerosis (ALS) Pathway (511); Axon Guidance Pathway (1366709); CREB Phosphorylation Through The Activation Of CaMKII Pathway (1368092); CREB Phosphorylation Through The Activation Of Ras Pathway (1368088); Cytokine Signaling In Immune System Pathway (1367586); DAP12 Interactions Pathway (1367572); DAP12 Signaling Pathway (1367573)
uniprot summary :
NFL: one of the three (L, M, and H) intermediate filament proteins that form neurofilaments. Neurofilaments are involved in the maintenance of neuronal caliber. NF-L is the most abundant of the three neurofilament proteins. Defects cause Charcot-Marie-Tooth disease type 1F (CMT1F). Protein type: Cytoskeletal. Chromosomal Location of Human Ortholog: 14 14 D1. Cellular Component: axon; cytoplasm; growth cone; intermediate filament; myelin sheath; neurofilament; neuron projection; TSC1-TSC2 complex. Molecular Function: identical protein binding; phospholipase binding; protein binding; protein binding, bridging; protein C-terminus binding; protein domain specific binding; protein heterodimerization activity; structural constituent of cytoskeleton. Biological Process: anterograde axon cargo transport; axon regeneration in the peripheral nervous system; axon transport of mitochondrion; intermediate filament bundle assembly; intermediate filament organization; intermediate filament polymerization and/or depolymerization; locomotion; microtubule cytoskeleton organization and biogenesis; negative regulation of neuron apoptosis; neurite morphogenesis; neurofilament bundle assembly; neurofilament cytoskeleton organization and biogenesis; neuromuscular process controlling balance; positive regulation of axonogenesis; protein polymerization; regulation of axon diameter; retrograde axon cargo transport