product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Homo sapiens Mucin-2
catalog :
MBS9422413
quantity :
0.01 mg
price :
200 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9422413
products type :
Recombinant Protein
products full name :
Recombinant Homo sapiens Mucin-2
products short name :
[Mucin-2]
products name syn :
[Intestinal mucin-2]
other names :
[Mucin-2; Mucin-2; mucin-2; mucin 2, oligomeric mucus/gel-forming; Intestinal mucin-2]
products gene name :
[MUC2]
other gene names :
[MUC2; MUC2; MLP; SMUC; MUC-2; SMUC; MUC-2]
host :
Yeast
reactivity :
Human
sequence positions :
[Full Length of VWFD 1 domain, 36-240aa]
sequence :
LAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQD
VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEF
AVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRH
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 monthsat -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Calculated MW: 24.8 kDa. Tag Info: N-terminal 6xHis-tagged
products description :
Coats the epithelia of the intestines, airways, and other mucus mbrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
ncbi gi num :
2506877
ncbi acc num :
Q02817.2
uniprot acc num :
Q02817
ncbi mol weight :
24.84kD
ncbi pathways :
Amoebiasis Pathway (167324); Amoebiasis Pathway (167191); C-type Lectin Receptors (CLRs) Pathway (1269303); Dectin-2 Family Pathway (1269308); Defective C1GALT1C1 Causes Tn Polyagglutination Syndrome (TNPS) Pathway (1383050); Defective GALNT12 Causes Colorectal Cancer 1 (CRCS1) Pathway (1383052); Defective GALNT3 Causes Familial Hyperphosphatemic Tumoral Calcinosis (HFTC) Pathway (1383051); Disease Pathway (1268854); Diseases Associated With O-glycosylation Of Proteins Pathway (1383049); Diseases Of Glycosylation Pathway (1269010)
ncbi summary :
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis. [provided by RefSeq, Oct 2016]
uniprot summary :
MUC2: Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer. Protein type: Extracellular matrix; Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 11p15.5. Cellular Component: Golgi lumen; plasma membrane. Molecular Function: protein binding. Biological Process: maintenance of gastrointestinal epithelium; O-glycan processing; stimulatory C-type lectin receptor signaling pathway
size1 :
0.01 mg
price1 :
200 USD
size2 :
0.05 mg
price2 :
250
size3 :
0.1 mg
price3 :
380
size4 :
0.2 mg
price4 :
590
size5 :
0.5 mg
price5 :
950
size6 :
1 mg
price6 :
1475
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!