catalog number :
MBS9422389
products type :
Recombinant Protein
products full name :
Recombinant Human Mannose-binding protein C
products short name :
[Mannose-binding protein C]
products name syn :
[Collectin-1MBP1Mannan-binding protein; Mannose-binding lectin]
other names :
[mannose-binding protein C; Mannose-binding protein C; mannose-binding protein C; mannose binding lectin 2; Collectin-1; MBP1; Mannan-binding protein; Mannose-binding lectin]
products gene name :
[MBL2]
other gene names :
[MBL2; MBL2; MBL; MBP; MBP1; MBPD; MBL2D; MBP-C; COLEC1; HSMBPC; COLEC1; MBL; MBP-C]
sequence positions :
[Full Length, 21-248aa]
sequence :
ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEK
GEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPG
KSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNK
FFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQN
LIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNN
AGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer, 50% Glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?C,-80?C. The shelf life of lyophilized form is 12 months at -20?C,-80?C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4?C for up to one week.
other info2 :
Tag Info: N-Terminal 6xHis-tagged
products description :
Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complent pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
ncbi acc num :
NP_000233.1
ncbi gb acc num :
NM_000242.2
ncbi pathways :
Complement And Coagulation Cascades Pathway (83073); Complement And Coagulation Cascades Pathway (484); Complement Cascade Pathway (106405); Creation Of C4 And C2 Activators Pathway (106407); Immune System Pathway (106386); Initial Triggering Of Complement Pathway (106406); Innate Immune System Pathway (106387); Lectin Pathway Of Complement Activation (106408); Phagosome Pathway (153910); Phagosome Pathway (153859)
ncbi summary :
This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. [provided by RefSeq, Jul 2008]
uniprot summary :
MBL2: Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 10q21.1. Cellular Component: cell surface; extracellular region; extracellular space. Molecular Function: calcium ion binding; calcium-dependent protein binding; mannose binding; protein binding; receptor binding; serine-type endopeptidase activity. Biological Process: acute-phase response; complement activation; complement activation, lectin pathway; defense response to bacterium; defense response to Gram-positive bacterium; innate immune response; negative regulation of viral reproduction; opsonization. Disease: Mannose-binding Protein Deficiency