product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Microtubule-associated protein tau
catalog :
MBS9422386
quantity :
0.01 mg
price :
230 USD
more info or order :
product information
catalog number :
MBS9422386
products type :
Recombinant Protein
products full name :
Recombinant Rat Microtubule-associated protein tau
products short name :
[Microtubule-associated protein tau]
products name syn :
[Neurofibrillary tangle protein; Paired helical filament-tau; PHF-tau]
other names :
[Microtubule-associated protein tau; Microtubule-associated protein tau; microtubule-associated protein tau; microtubule-associated protein tau; Neurofibrillary tangle protein; Paired helical filament-tau; PHF-tau]
products gene name :
[TAU]
other gene names :
[Mapt; Mapt; Tau; pTau; Mtapt; RNPTAU; Mtapt; Tau; PHF-tau]
host :
Yeast
reactivity :
Rat
sequence positions :
[Full Length, 2-752aa]
sequence :
AEPRQEFDTMEDQAGDYTMLQDQEGDMDHGLKESPPQPP
ADDGSEEPGSETSDAKSTPTAEDVTAPLVEERAPDKQAT
AQSHTEIPEGTTAEEAGIGDTPNMEDQAAGHVTQEPQKV
EIFSQSLLVEPGRREGQAPDSGISDWTHQQVPSMSGAPL
PPQGLREATHQPLGTRPEDVERSHPASELLWQESPQKEA
WGKDRLGSEEEVDEDITMDESSQESPPSQASLAPGTATP
QARSVSASGVSGETTSIPGFPAEGSIPLPADFFSKVSAE
TQASPPEGPGTGPSEEGHEAAPEFTFHVEIKASAPKEQD
LEGATVVGAPAEEQKARGPSVGKGTKEASLLEPTDKQPA
AGLPGRPVSRVPQLKARVAGVSKDRTGNDEKKAKTSTPS
CAKTPSNRPCLSPTRPTPGSSDPLIKPSSPAVCPEPATS
PKYVSSVTPRNGSPGTKQMKLKGADGKTGAKIATPRGAA
TPGQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERSGY
SSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSP
SASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKV
QIINKKLDLSNVQSKCGSKDNIKHVPGGGSVHIVYKPVD
LSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSK
IGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEI
VYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADE
VSASLAKQGL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info2 :
Tag Info: His-tag
products description :
Promotes microtubule assbly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma mbrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.
ncbi gi num :
13432197
ncbi acc num :
P19332.3
uniprot acc num :
P19332
ncbi mol weight :
80.4kD
ncbi pathways :
Alzheimer's Disease Pathway (83489); Alzheimer's Disease Pathway (509); Apoptosis Pathway (1121747); Apoptotic Cleavage Of Cellular Proteins Pathway (1121770); Apoptotic Execution Phase Pathway (1121769); Caspase-mediated Cleavage Of Cytoskeletal Proteins Pathway (1121771); MAPK Signaling Pathway (198496); MAPK Signaling Pathway (83440); MAPK Signaling Pathway (456); Programmed Cell Death Pathway (1121740)
ncbi summary :
a microtubule-associated protein; expression is found specifically in neurons [RGD, Feb 2006]
uniprot summary :
Tau: a microtubule-associated protein that regulates microtubule assembly and stability. Apparently involved in the establishment and maintenance of neuronal polarity. Mutations can result in several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. Nine differentially spliced isoforms have been described. The short isoforms allow plasticity of the cytoskeleton, whereas the longer isoforms may preferentially play a role in its stabilization. Protein type: Cytoskeletal. Chromosomal Location of Human Ortholog: 10q32.1. Cellular Component: axolemma; axon; axoneme; cell soma; cytoplasm; cytosol; dendrite; growth cone; internal side of plasma membrane; membrane; microtubule; microtubule associated complex; microtubule cytoskeleton; neuron projection; nuclear speck; nucleus; plasma membrane; postsynaptic density; tubulin complex. Molecular Function: apolipoprotein binding; DNA binding; enzyme binding; Hsp90 protein binding; identical protein binding; microtubule binding; protein binding; protein complex binding; protein domain specific binding; protein homodimerization activity; protein kinase binding; protein phosphatase 2A binding; receptor agonist activity; SH3 domain binding. Biological Process: adult walking behavior; apoptosis; axon cargo transport; axon extension; axonogenesis; brain development; female pregnancy; induction of apoptosis by oxidative stress; intracellular distribution of mitochondria; memory; microtubule cytoskeleton organization and biogenesis; mitochondrion transport along microtubule; negative regulation of intracellular transport; negative regulation of kinase activity; neurite development; neuron migration; positive regulation of axon extension; positive regulation of microtubule polymerization; positive regulation of superoxide release; regulation of autophagy; regulation of calcium-mediated signaling; regulation of microtubule polymerization or depolymerization; response to nutrient; response to organic substance; synapse organization and biogenesis
size1 :
0.01 mg
price1 :
230 USD
size2 :
0.05 mg
price2 :
290
size3 :
0.1 mg
price3 :
455
size4 :
0.2 mg
price4 :
705
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1800
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!