product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta Interleukin-15
catalog :
MBS9422344
quantity :
0.01 mg
price :
290 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9422344
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta Interleukin-15
products short name :
[Interleukin-15]
other names :
[interleukin-15; Interleukin-15; interleukin-15]
products gene name :
[IL15]
other gene names :
[IL15; IL15; IL-15; IL-15]
host :
Yeast
reactivity :
MACMU
sequence positions :
[Full Length, 49-162aa]
sequence :
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTA
MKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNG
NITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 monthsat -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Immunogen Description: Expression Region:49-162aaSequence Info:Full Length . Tag Info: N-terminal 6xHis-tagged .
products description :
Recombinant Protein. Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2Rbeta and probably IL-2R gamma but not IL-2R alpha.
ncbi gi num :
113461953
ncbi acc num :
NP_001038196.1
ncbi gb acc num :
NM_001044731.1
uniprot acc num :
P48092
ncbi mol weight :
Calculated MW: 14.9 kD
ncbi pathways :
Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460); HTLV-I Infection Pathway (373904); HTLV-I Infection Pathway (373889); Herpes Simplex Infection Pathway (377876); Herpes Simplex Infection Pathway (377865); Intestinal Immune Network For IgA Production Pathway (128763); Intestinal Immune Network For IgA Production Pathway (128670); Jak-STAT Signaling Pathway (86747); Jak-STAT Signaling Pathway (488)
uniprot summary :
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
size1 :
0.01 mg
price1 :
290 USD
size2 :
0.05 mg
price2 :
385
size3 :
0.1 mg
price3 :
620
size4 :
0.2 mg
price4 :
990
size5 :
0.5 mg
price5 :
1365
size6 :
1 mg
price6 :
2140
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!