Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 2 | MyBioSource MBS9422327 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 2

catalog :

MBS9422327

quantity :

0.01 mg

price :

200 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS9422327

products type :

Recombinant Protein

products full name :

Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 2

products short name :

[Corticosteroid 11-beta-dehydrogenase isozyme 2]

products name syn :

[11-beta-hydroxysteroid dehydrogenase type 2; 11-DH2; 11-beta-HSD211-beta-hydroxysteroid dehydrogenase type II; -HSD11 type IINAD-dependent 11-beta-hydroxysteroid dehydrogenase; 11-beta-HSD; Short chain dehydrogenase/reductase family 9C member 3]

other names :

[corticosteroid 11-beta-dehydrogenase isozyme 2; Corticosteroid 11-beta-dehydrogenase isozyme 2; corticosteroid 11-beta-dehydrogenase isozyme 2; hydroxysteroid 11-beta dehydrogenase 2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-DH2; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type II; 11-HSD type II; 11-beta-HSD type II; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; 11-beta-HSD; Short chain dehydrogenase/reductase family 9C member 3]

products gene name :

[DHI2]

other gene names :

[HSD11B2; HSD11B2; AME; AME1; HSD2; HSD11K; SDR9C3; ; 11-DH2; 11-beta-HSD2; 11-HSD type II; 11-beta-HSD type II; 11-beta-HSD]

host :

Yeast

sequence :

RPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISR VLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSP AGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELL QAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAF FISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALA
LLAALDWLCQRLLPPPAALAVLAAAGWIALSRLA

purity :

Greater than 90% as determined by SDS-PAGE.

form :

20mM Tris-HCl based buffer, pH8.0

storage stability :

Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

other info1 :

Target Name: DHI2. Target Species: Human. Target Lenght: Full Length, 1-405aa

other info2 :

Tag Info: His-tag

products description :

Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.

ncbi gi num :

119392083

ncbi acc num :

NP_000187.3

ncbi gb acc num :

NM_000196.3

uniprot acc num :

P80365

ncbi mol weight :

46.1kD

ncbi pathways :

Aldosterone-regulated Sodium Reabsorption Pathway (130626); Aldosterone-regulated Sodium Reabsorption Pathway (130590); C21-Steroid Hormone Biosynthesis, Progesterone = Cortisol/cortisone Pathway (413395); C21-Steroid Hormone Biosynthesis, Progesterone = Cortisol/cortisone Pathway (468370); Glucocorticoid Mineralcorticoid Metabolism Pathway (198902); Glucocorticoid Biosynthesis Pathway (1270048); Metabolism Pathway (1269956); Metabolism Of Lipids And Lipoproteins Pathway (1270001); Metabolism Of Steroid Hormones Pathway (1270046); Prostaglandin Synthesis And Regulation Pathway (198912)

ncbi summary :

There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension. [provided by RefSeq, Feb 2010]

uniprot summary :

HSD11B2: Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. Defects in HSD11B2 are the cause of apparent mineralocorticoid excess (AME). An autosomal recessive form of low-renin hypertension. It is usually diagnosed within the first years of life and is characterized by polyuria and polydipsia, failure to thrive, hypernatremia, severe hypertension with low renin and aldosterone levels, profound hypokalemia with metabolic alkalosis, and most often nephrocalcinosis. Belongs to the short-chain dehydrogenases/reductases (SDR) family. Protein type: EC 1.1.1.-; Lipid Metabolism - C21-steroid hormone; Lipid Metabolism - androgen and estrogen; Oxidoreductase. Chromosomal Location of Human Ortholog: 16q22.1. Cellular Component: endoplasmic reticulum membrane. Molecular Function: 11-beta-hydroxysteroid dehydrogenase activity. Biological Process: glucocorticoid biosynthetic process. Disease: Apparent Mineralocorticoid Excess

size1 :

0.01 mg

price1 :

200 USD

size2 :

0.05 mg

price2 :

250

size3 :

0.1 mg

price3 :

380

size4 :

0.2 mg

price4 :

590

size5 :

0.5 mg

price5 :

950

size6 :

1 mg

price6 :

1475

more info or order :

MyBioSource product webpage