protein

Recombinant Human Granzyme B

MBS9422317

0.01 mg

200 USD

Recombinant Protein

Recombinant Human Granzyme B

[Granzyme B]

[C11CTLA-1Cathepsin G-like 1; CTSGL1Cytotoxic T-lymphocyte proteinase 2; Lymphocyte proteaseFragmentin-2Granzyme-2Human lymphocyte protein; HLPSECTT-cell serine protease 1-3E]

[granzyme B isoform 1 preproprotein; Granzyme B; granzyme B; granzyme B; C11; CTLA-1; Cathepsin G-like 1; CTSGL1; Cytotoxic T-lymphocyte proteinase 2; Lymphocyte protease; Fragmentin-2; Granzyme-2; Human lymphocyte protein; HLP; SECT; T-cell serine protease 1-3E]

[GRAB]

[GZMB; GZMB; C11; HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1; CGL1; CSPB; CTLA1; GRB; CTSGL1; Lymphocyte protease; HLP]

Yeast

Human

[Full Length, 21-247aa]

IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFV
LTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHP
AYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVK
PGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESD
LRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQG
IVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Greater than 90% as determined by SDS-PAGE.

20mM Tris-HCl based buffer, pH8.0

Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Calculated MW: 27.5 kD

Tag Info: His-tag

This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Ses to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.

221625528

NP_004122.2

NM_004131.5

P10144

27.5kD

Activation, Myristolyation Of BID And Translocation To Mitochondria Pathway (105657); Allograft Rejection Pathway (83123); Allograft Rejection Pathway (535); Apoptosis Pathway (198797); Apoptosis Pathway (105648); Autoimmune Thyroid Disease Pathway (83121); Autoimmune Thyroid Disease Pathway (533); Caspase Cascade In Apoptosis Pathway (137974); Downstream Signaling In Naive CD8+ T Cells Pathway (138018); Graft-versus-host Disease Pathway (83124)

This gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Expression of this gene may be elevated in human patients with cardiac fibrosis. [provided by RefSeq, Sep 2016]

GZMB: This enzyme is necessary for target cell lysis in cell- mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis. By staphylococcal enterotoxin A (SEA) in peripheral blood leukocytes. Inactivated by the serine protease inhibitor diisopropylfluorophosphate. Belongs to the peptidase S1 family. Granzyme subfamily. Protein type: Apoptosis; EC 3.4.21.79; Protease. Chromosomal Location of Human Ortholog: 14q12. Cellular Component: cytosol; immunological synapse; membrane; nucleus; secretory granule. Molecular Function: protein binding; serine-type endopeptidase activity; serine-type peptidase activity. Biological Process: apoptosis; induction of apoptosis by granzyme; natural killer cell mediated cytotoxicity

0.01 mg

200 USD

0.05 mg

250

0.1 mg

380

0.2 mg

590

0.5 mg

950

1 mg

1475