product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Glucagon-like peptide 1 receptor
catalog :
MBS9422304
quantity :
0.01 mg
price :
200 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9422304
products type :
Recombinant Protein
products full name :
Recombinant Human Glucagon-like peptide 1 receptor
products short name :
[Glucagon-like peptide 1 receptor]
other names :
[glucagon-like peptide 1 receptor; Glucagon-like peptide 1 receptor; glucagon-like peptide 1 receptor; glucagon like peptide 1 receptor]
products gene name :
[GLP1R]
other gene names :
[GLP1R; GLP1R; GLP-1; GLP-1R; GLP-1-R; GLP-1 receptor; GLP-1-R; GLP-1R]
host :
Yeast
sequence positions :
[Extracellular Domain, 24-145aa]
sequence :
RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFC
NRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVY
RFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQ
LLFLY
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20°C, for extended storage, conserve at -20° C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Calculated MW: 16.3kD. Target Species : Human
other info2 :
Tag Info: His-tag
products description :
Recombinant protein. This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
ncbi gi num :
166795283
ncbi acc num :
NP_002053.3
ncbi gb acc num :
NM_002062.4
uniprot acc num :
P43220
ncbi pathways :
Class B/2 (Secretin Family Receptors) Pathway (106378); G Alpha (s) Signalling Events Pathway (119549); GPCR Downstream Signaling Pathway (119548); GPCR Ligand Binding Pathway (161020); GPCRs, Class B Secretin-like Pathway (198781); Glucagon-type Ligand Receptors Pathway (106380); Insulin Secretion Pathway (777534); Integration Of Energy Metabolism Pathway (106096); Metabolism Pathway (477135); Neuroactive Ligand-receptor Interaction Pathway (83053)
ncbi summary :
This gene encodes a 7-transmembrane protein that functions as a receptor for glucagon-like peptide 1 (GLP-1) hormone, which stimulates glucose-induced insulin secretion. This receptor, which functions at the cell surface, becomes internalized in response to GLP-1 and GLP-1 analogs, and it plays an important role in the signaling cascades leading to insulin secretion. It also displays neuroprotective effects in animal models. Polymorphisms in this gene are associated with diabetes. The protein is an important drug target for the treatment of type 2 diabetes and stroke. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2016]
uniprot summary :
GLP1R: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family. Protein type: GPCR, family 2; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR. Chromosomal Location of Human Ortholog: 6p21.2. Cellular Component: integral to membrane; integral to plasma membrane; plasma membrane. Molecular Function: protein binding; transmembrane receptor activity. Biological Process: adenylate cyclase activation; cAMP-mediated signaling; elevation of cytosolic calcium ion concentration; G-protein signaling, adenylate cyclase activating pathway; regulation of insulin secretion
size1 :
0.01 mg
price1 :
200 USD
size2 :
0.05 mg
price2 :
250
size3 :
0.1 mg
price3 :
380
size4 :
0.2 mg
price4 :
590
size5 :
0.5 mg
price5 :
950
size6 :
1 mg
price6 :
1475
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!