protein

Recombinant Human Early growth response protein 1

MBS9422275

0.01 mg

200 USD

Recombinant Protein

Recombinant Human Early growth response protein 1

[Early growth response protein 1]

[AT225Nerve growth factor-induced protein A; NGFI-ATranscription factor ETR103Transcription factor Zif268Zinc finger protein 225Zinc finger protein Krox-24]

[early growth response protein 1; Early growth response protein 1; early growth response protein 1; early growth response 1; AT225; Nerve growth factor-induced protein A; NGFI-A; Transcription factor ETR103; Transcription factor Zif268; Zinc finger protein 225]

[EGR1]

[EGR1; EGR1; TIS8; AT225; G0S30; NGFI-A; ZNF225; KROX-24; ZIF-268; ; NGFI-A]

Yeast

[Expression Region: 444-543. Sequence Info:Partial]

543

AVTNSFSASTGLSDMTATFSPRTIEIC
SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTY
PSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Greater than 90% as determined by SDS-PAGE.

Tris-based buffer 50% glycerol

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Calculated MW: 12.1 kDa

Tag Info: N-terminal 6xHis-tagged

Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3' (EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.

4503493

NP_001955.1

NM_001964.2

P18146

BDNF Signaling Pathway (712093); Calcineurin-regulated NFAT-dependent Transcription In Lymphocytes Pathway (137993); Cytokine Signaling In Immune System Pathway (366171); Downstream Signaling In Naive CD8+ T Cells Pathway (138018); ErbB1 Downstream Signaling Pathway (138057); Glucocorticoid Receptor Regulatory Network Pathway (138014); HTLV-I Infection Pathway (373901); HTLV-I Infection Pathway (373889); Immune System Pathway (106386); Insulin Signaling Pathway (198845)

The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppressor gene. [provided by RefSeq, Dec 2014]

EGR1: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation. By growth factors. Belongs to the EGR C2H2-type zinc-finger protein family. Protein type: C2H2-type zinc finger protein; DNA-binding; Transcription factor. Chromosomal Location of Human Ortholog: 5q31.2. Cellular Component: cytoplasm; nucleoplasm; nucleus. Molecular Function: DNA binding; double-stranded methylated DNA binding; histone acetyltransferase binding; protein binding; sequence-specific DNA binding; transcription factor activity; zinc ion binding. Biological Process: positive regulation of chemokine biosynthetic process; positive regulation of hormone biosynthetic process; positive regulation of interleukin-1 beta biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of protein sumoylation; response to hypoxia; transcription from RNA polymerase II promoter

0.01 mg

200 USD

0.05 mg

250

0.1 mg

380

0.2 mg

590

0.5 mg

950

1 mg

1475