catalog number :
MBS9422266
products type :
Recombinant Protein
products full name :
Recombinant Homo sapiens Dynamin-1
products short name :
[Dynamin-1]
other names :
[dynamin-1 isoform 2; Dynamin-1; dynamin-1; dynamin 1]
products gene name :
[DYN1]
other gene names :
[DNM1; DNM1; DNM; EIEE31; DNM]
sequence positions :
[Partial, 2-245aa]
sequence :
GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQ
SAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTE
YAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPV
PINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIR
DMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQ
GQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVV
NRSQKDIDGK
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info2 :
Calculated MW: 28.73 kD. Tag Info: His-tag
products description :
Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Involved in receptor-mediated endocytosis.
ncbi acc num :
NP_001005336.1
ncbi gb acc num :
NM_001005336.2
ncbi pathways :
Adaptive Immune System Pathway (366160); Axon Guidance Pathway (105688); Bacterial Invasion Of Epithelial Cells Pathway (149807); Bacterial Invasion Of Epithelial Cells Pathway (148661); CXCR3-mediated Signaling Events Pathway (138011); CXCR4-mediated Signaling Events Pathway (137910); Developmental Biology Pathway (477129); EGFR1 Signaling Pathway (198782); EPHB Forward Signaling Pathway (138047); Endocrine And Other Factor-regulated Calcium Reabsorption Pathway (213307)
ncbi summary :
This gene encodes a member of the dynamin subfamily of GTP-binding proteins. The encoded protein possesses unique mechanochemical properties used to tubulate and sever membranes, and is involved in clathrin-mediated endocytosis and other vesicular trafficking processes. Actin and other cytoskeletal proteins act as binding partners for the encoded protein, which can also self-assemble leading to stimulation of GTPase activity. More than sixty highly conserved copies of the 3' region of this gene are found elsewhere in the genome, particularly on chromosomes Y and 15. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
uniprot summary :
DYN1: a microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes. Concentrates within the presynaptic compartment and may participate in specialized neuronal functions such as rapid synaptic vesicle recycling. Part of a protein network that controls nucleation of actin from membranes. Contains one PH domain. Protein type: EC 3.6.5.5; Hydrolase; Microtubule-binding; Motility/polarity/chemotaxis; Motor; Vesicle. Chromosomal Location of Human Ortholog: 9q34.11. Cellular Component: mitochondrial membrane; plasma membrane. Molecular Function: GTPase activity; identical protein binding; microtubule binding; protein binding; protein kinase binding; RNA binding. Biological Process: endocytosis; endosome organization and biogenesis; ephrin receptor signaling pathway; mitochondrial fission; receptor-mediated endocytosis. Disease: Epileptic Encephalopathy, Early Infantile, 31