protein

Recombinant mouse Apolipoprotein E

MBS9422184

0.01 mg

230 USD

Recombinant Protein

Recombinant mouse Apolipoprotein E

[Apolipoprotein E]

[apolipoprotein E; Apolipoprotein E; apolipoprotein E; apolipoprotein E]

[APOE]

[Apoe; Apoe; Apo-E; AI255918; Apo-E]

Yeast

[Full length, 19-311aa]

311

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQV
QEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVA
EETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTM
LGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKA
GAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPL
RDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSK
MEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLME
KIQASVATNPIITPVAQENQ

Greater than 90% as determined by SDS-PAGE.

Tris-based buffer 50% glycerol

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Tag Info: N-terminal 6xHis-tagged

Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron rnant) of hepatic tissues.

802084029

NP_001292748.1

NM_001305819.1

P08226

36 kDa

Alzheimer's Disease Pathway (83294); Alzheimer's Disease Pathway (509); Binding And Uptake Of Ligands By Scavenger Receptors Pathway (1367201); Chylomicron-mediated Lipid Transport Pathway (1367662); HDL-mediated Lipid Transport Pathway (1367663); Lipid Digestion, Mobilization, And Transport Pathway (1367658); Lipoprotein Metabolism Pathway (1367661); Metabolism Pathway (1367614); Metabolism Of Fat-soluble Vitamins Pathway (1367813); Metabolism Of Lipids And Lipoproteins Pathway (1367657)

This gene encodes a member of the apolipoprotein A1/A4/E family of proteins. This protein is involved in the transport of lipoproteins in the blood. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Homozygous knockout mice for this gene accumulate high levels of cholesterol in the blood and develop atherosclerosis. Different alleles of this gene have been associated with either increased risk or a protective effect for Alzheimer's disease in human patients. This gene maps to chromosome 7 in a cluster with the related apolipoprotein C1, C2 and C4 genes. [provided by RefSeq, Apr 2015]

APOE: Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. Defects in APOE are a cause of hyperlipoproteinemia type 3 (HLPP3); also known as familial dysbetalipoproteinemia. Individuals with HLPP3 are clinically characterized by xanthomas, yellowish lipid deposits in the palmar crease, or less specific on tendons and on elbows. The disorder rarely manifests before the third decade in men. In women, it is usually expressed only after the menopause. The vast majority of the patients are homozygous for APOE*2 alleles. More severe cases of HLPP3 have also been observed in individuals heterozygous for rare APOE variants. The influence of APOE on lipid levels is often suggested to have major implications for the risk of coronary artery disease (CAD). Individuals carrying the common APOE*4 variant are at higher risk of CAD. Genetic variations in APOE are associated with Alzheimer disease type 2 (AD2). It is a late-onset neurodegenerative disorder characterized by progressive dementia, loss of cognitive abilities, and deposition of fibrillar amyloid proteins as intraneuronal neurofibrillary tangles, extracellular amyloid plaques and vascular amyloid deposits. The major constituent of these plaques is the neurotoxic amyloid-beta-APP 40-42 peptide (s), derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C-terminal fragments (CTFs) and the caspase-cleaved products such as C31 derived from APP, are also implicated in neuronal death. The APOE*4 allele is genetically associated with the common late onset familial and sporadic forms of Alzheimer disease. Risk for AD increased from 20% to 90% and mean age at onset decreased from 84 to 68 years with increasing number of APOE*4 alleles in 42 families with late onset AD. Thus APOE*4 gene dose is a major risk factor for late onset AD and, in these families, homozygosity for APOE*4 was virtually sufficient to cause AD by age 80. The mechanism by which APOE*4 participates in pathogenesis is not known. Defects in APOE are a cause of sea-blue histiocyte disease (SBHD); also known as sea-blue histiocytosis. This disorder is characterized by splenomegaly, mild thrombocytopenia and, in the bone marrow, numerous histiocytes containing cytoplasmic granules which stain bright blue with the usual hematologic stains. The syndrome is the consequence of an inherited metabolic defect analogous to Gaucher disease and other sphingolipidoses. Defects in APOE are a cause of lipoprotein glomerulopathy (LPG). LPG is an uncommon kidney disease characterized by proteinuria, progressive kidney failure, and distinctive lipoprotein thrombi in glomerular capillaries. It mainly affects people of Japanese and Chinese origin. The disorder has rarely been described in Caucasians. Belongs to the apolipoprotein A1/A4/E family. Protein type: Lipid-binding; Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 7 A3 7 9.94 cM. Cellular Component: cell soma; cell surface; chylomicron; cytoplasm; dendrite; early endosome; endoplasmic reticulum; endosome; extracellular matrix; extracellular region; extracellular space; extrinsic to external side of plasma membrane; Golgi apparatus; late endosome; lysosome; membrane; microtubule; nuclear envelope; nucleus; plasma membrane. Molecular Function: antioxidant activity; beta-amyloid binding; cholesterol binding; cholesterol transporter activity; heparin binding; hydroxyapatite binding; identical protein binding; lipid binding; lipid transporter activity; low-density lipoprotein receptor binding; metal chelating activity; phospholipid binding; protein binding; protein dimerization activity; protein homodimerization activity; receptor binding; tau protein binding. Biological Process: aging; amyloid precursor protein metabolic process; artery morphogenesis; axon regeneration; cellular calcium ion homeostasis; cGMP-mediated signaling; cholesterol biosynthetic process; cholesterol catabolic process; cholesterol efflux; cholesterol homeostasis; cholesterol metabolic process; fatty acid homeostasis; G-protein coupled receptor protein signaling pathway; lipid homeostasis; lipid metabolic process; lipid transport; lipoprotein biosynthetic process; lipoprotein catabolic process; lipoprotein metabolic process; long-chain fatty acid transport; maintenance of cellular localization; negative regulation of blood coagulation; negative regulation of blood vessel endothelial cell migration; negative regulation of cellular protein metabolic process; negative regulation of cholesterol biosynthetic process; negative regulation of endothelial cell proliferation; negative regulation of inflammatory response; negative regulation of MAP kinase activity; negative regulation of neuron apoptosis; neurite regeneration; nitric oxide mediated signal transduction; phospholipid efflux; positive regulation of axon extension; positive regulation of cGMP biosynthetic process; positive regulation of endocytosis; positive regulation of lipid biosynthetic process; positive regulation of low-density lipoprotein receptor catabolic process; positive regulation of membrane protein ectodomain proteolysis; positive regulation of nitric-oxide synthase activity; protein import; protein localization; receptor-mediated endocytosis; regulation of axon extension; regulation of Cdc42 protein signal transduction; regulation of cholesterol transport; regulation of gene expression; regulation of protein homooligomerization; response to dietary excess; response to oxidative stress; reverse cholesterol transport; triacylglycerol catabolic process; triacylglycerol metabolic process; vasodilation; virus assembly

0.01 mg

230 USD

0.05 mg

290

0.1 mg

455

0.2 mg

705

0.5 mg

1145

1 mg

1800