product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Interleukin-18-binding protein
catalog :
MBS9422084
quantity :
0.01 mg
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9422084
products type :
Recombinant Protein
products full name :
Recombinant Human Interleukin-18-binding protein
products short name :
[Interleukin-18]
products name syn :
[Tadekinig-alfa]
other names :
[interleukin-18-binding protein isoform a; Interleukin-18-binding protein; interleukin-18-binding protein; interleukin 18 binding protein; Tadekinig-alfa]
products gene name :
[I18BP]
other gene names :
[IL18BP; IL18BP; IL18BPa; IL-18BP]
host :
E Coli
reactivity :
Human
sequence :
TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEV
TWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIE
HLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTN
FSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEAL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
other info1 :
Immunogen Description: Expression Region:31-183aaSequence Info:Partial. Calculated MW: 20.5 kDa. Tag Info: N-terminal 6xHis-tagged
products description :
Recombinant Protein. Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
ncbi gi num :
89111125
ncbi acc num :
NP_001034748.1
ncbi gb acc num :
NM_001039659.1
uniprot acc num :
O95998
ncbi summary :
The protein encoded by this gene functions as an inhibitor of the proinflammatory cytokine, IL18. It binds IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2011]
uniprot summary :
IL18BP: Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 11q13.4. Cellular Component: extracellular region; extracellular space. Molecular Function: interleukin-18 binding; receptor antagonist activity. Biological Process: T-helper 1 type immune response
size1 :
0.01 mg
price1 :
180 USD
size2 :
0.05 mg
price2 :
225
size3 :
0.1 mg
price3 :
320
size4 :
0.2 mg
price4 :
500
size5 :
0.5 mg
price5 :
800
size6 :
1 mg
price6 :
1235
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!