protein

Recombinant Human Transcription factor PU.1

MBS9422073

0.01 mg

205 USD

Recombinant Protein

Recombinant Human Transcription factor PU.1

[Transcription factor PU.1]

[31 kDa-transforming protein]

[transcription factor PU.1 isoform 1; Transcription factor PU.1; transcription factor PU.1; Spi-1 proto-oncogene; 31 kDa-transforming protein]

[SPI1]

[SPI1; SPI1; OF; PU.1; SFPI1; SPI-1; SPI-A]

E Coli

Human

[Full Length, 1-270aa]

MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYL
SSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQP
PQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRM
CLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPG
PGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKD
KGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRN
YGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH

Greater than 85% as determined by SDS-PAGE.

Tris-based buffer50% glycerol

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Immunogen: Expression Region:1-270aaSequence Info:Full Length

Tag Info: N-terminal 6xHis-tagged

Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing.

124028521

NP_001074016.1

NM_001080547.1

P17947

35.1 kDa

Acute Myeloid Leukemia Pathway (83117); Acute Myeloid Leukemia Pathway (529); C-MYB Transcription Factor Network Pathway (138073); Epstein-Barr Virus Infection Pathway (585562); Epstein-Barr Virus Infection Pathway (587115); Glucocorticoid Receptor Regulatory Network Pathway (138014); HTLV-I Infection Pathway (373901); HTLV-I Infection Pathway (373889); IL-3 Signaling Pathway (198881); IL-4 Signaling Pathway (198760)

This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

PU.1: Binds to the PU-box, a purine-rich DNA sequence (5'- GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B- cells. Also binds RNA and may modulate pre-mRNA splicing. Binds DNA as a monomer. Interacts with CEBPD and NONO. Interacts with RUNX1 and SPIB. Interacts with GFI1; the interaction represses SPI1 transcriptional activity. Highly expressed in both FV-P and FV-A-induced erythro- leukemia cell lines that have undergone rearrangements of the Spi- 1 gene due to the insertion of SFFV. Belongs to the ETS family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: DNA-binding; Oncoprotein; Transcription factor. Chromosomal Location of Human Ortholog: 11p11.2. Cellular Component: nuclear chromatin; nucleoplasm. Molecular Function: NFAT protein binding; protein binding; RNA polymerase II transcription factor activity, enhancer binding; transcription factor activity. Biological Process: negative regulation of gene expression, epigenetic; negative regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of erythrocyte differentiation; regulation of transcription from RNA polymerase II promoter

0.01 mg

205 USD

0.05 mg

255

0.1 mg

390

0.2 mg

600

0.5 mg

970

1 mg

1510