Recombinant Human Protein Wnt-3a | MyBioSource MBS9422044 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Protein Wnt-3a

catalog :

MBS9422044

quantity :

0.01 mg

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS9422044

products type :

Recombinant Protein

products full name :

Recombinant Human Protein Wnt-3a

products short name :

[Wnt-3a]

products name syn :

[WNT3A]

other names :

[protein Wnt-3a; Protein Wnt-3a; protein Wnt-3a; Wnt family member 3A]

products gene name :

[Wnt-3a]

other gene names :

[WNT3A; WNT3A]

host :

E Coli

reactivity :

Human

sequence positions :

[Partial of the Full Length of 19-352aa, 19-351aa]

sequence :

SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCR
NYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLA
IFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAI
CGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARE
NRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCE
VKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGW
VETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFG
TRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCV
FHWCCYVSCQECTRVYDVHTC

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Tri-based buffer 50% glycerol.

storage stability :

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

other info2 :

Tag Info: N-Terminal 6xHis-tagged

products description :

Ligand for mbers of the frizzled family of seven transmbrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.

ncbi gi num :

14916475

ncbi acc num :

NP_149122.1

ncbi gb acc num :

NM_033131.3

uniprot acc num :

P56704

ncbi mol weight :

41.3kD

ncbi pathways :

Basal Cell Carcinoma Pathway (83113); Basal Cell Carcinoma Pathway (525); Canonical Wnt Signaling Pathway (138032); Cardiac Progenitor Differentiation Pathway (712094); Class B/2 (Secretin Family Receptors) Pathway (106378); DNA Damage Response (only ATM Dependent) Pathway (198827); Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway (1127664); Disease Pathway (530764); GPCR Ligand Binding Pathway (161020); HTLV-I Infection Pathway (373901)

ncbi summary :

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region. [provided by RefSeq, Jul 2008]

uniprot summary :

WNT3A: Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. Interacts with PORCN. Interacts with APCDD1 and WLS. Component of the Wnt-Fzd-LRP5-LRP6 signaling complex that contains a WNT protein, a FZD protein and LRP5 or LRP6. Interacts directly in the complex with LRP6. Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate. Belongs to the Wnt family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 1q42.13. Cellular Component: cell surface; early endosome membrane; endoplasmic reticulum lumen; extracellular region; extracellular space; Golgi lumen; plasma membrane. Molecular Function: frizzled binding; protein binding; receptor agonist activity; receptor binding; transcription coactivator activity. Biological Process: cell proliferation in forebrain; cell proliferation in midbrain; negative regulation of neurogenesis; neuron differentiation; palate development; positive regulation of cell proliferation; positive regulation of mesodermal cell fate specification; positive regulation of peptidyl-serine phosphorylation; positive regulation of protein amino acid phosphorylation; positive regulation of protein binding; positive regulation of receptor internalization; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; signalosome assembly; Wnt receptor signaling pathway; Wnt receptor signaling pathway through beta-catenin

size1 :

0.01 mg

price1 :

180 USD

size2 :

0.05 mg

price2 :

225

size3 :

0.1 mg

price3 :

320

size4 :

0.2 mg

price4 :

500

size5 :

0.5 mg

price5 :

800

size6 :

1 mg

price6 :

1235

more info or order :

MyBioSource product webpage