product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Receptor tyrosine-protein kinase erbB-2
catalog :
MBS9421882
quantity :
0.01 mg
price :
180 USD
more info or order :
product information
catalog number :
MBS9421882
products type :
Recombinant Protein
products full name :
Recombinant Human Receptor tyrosine-protein kinase erbB-2
products short name :
[Receptor tyrosine-protein kinase erbB-2]
products name syn :
[Metastatic lymph node gene 19 protein; MLN 19Proto-oncogene NeuProto-oncogene c-ErbB-2Tyrosine kinase-type cell surface receptor HER2p185erbB2; CD340]
other names :
[receptor tyrosine-protein kinase erbB-2 isoform b; Receptor tyrosine-protein kinase erbB-2; receptor tyrosine-protein kinase erbB-2; erb-b2 receptor tyrosine kinase 2; Metastatic lymph node gene 19 protein; MLN 19; Proto-oncogene Neu; Proto-oncogene c-ErbB-2; Tyrosine kinase-type cell surface receptor HER2; p185erbB2; CD_antigen: CD340]
products gene name :
[ERBB2]
other gene names :
[ERBB2; ERBB2; NEU; NGL; HER2; TKR1; CD340; HER-2; MLN 19; HER-2/neu; HER2; MLN19; NEU; NGL; MLN 19]
host :
E Coli
reactivity :
Human
sequence positions :
[153-598aa]
sequence :
VLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRA
CHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGP
LPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCP
ALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDV
GSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGM
EHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPA
SNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVF
QNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSG
LALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDE
CVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVE
ECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEA
DQCVACAHYKDPPFCVA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Immunogen Description: Expression Region:153-598aaSequence Info:Partial. Calculated MW: 53.1 kDa
other info2 :
Tag Info: N-terminal 6xHis-tagged
products description :
Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell mbrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell mbrane. In turn, mbrane-bound APC allows the localization of MACF1 to the cell mbrane, which is required for microtubule capture and stabilization.In the nucleus is involved in transcriptional regulation. Associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. Implicated in transcriptional activation of CDKN1A; the function involves STAT3 and SRC. Involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth.
ncbi gi num :
54792098
ncbi acc num :
NP_001005862.1
ncbi gb acc num :
NM_001005862.2
uniprot acc num :
P04626
ncbi mol weight :
53.2kD
ncbi pathways :
Adaptive Immune System Pathway (366160); Adherens Junction Pathway (83070); Adherens Junction Pathway (481); Alpha6-Beta4 Integrin Signaling Pathway (198807); Axon Guidance Pathway (105688); Bladder Cancer Pathway (83115); Bladder Cancer Pathway (527); Calcium Signaling Pathway (83050); Calcium Signaling Pathway (459); Constitutive PI3K/AKT Signaling In Cancer Pathway (685535)
ncbi summary :
This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq, Jul 2008]
uniprot summary :
HER2: a proto-oncogenic receptor tyrosine kinase of the EGFR family. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. Not activated by EGF, TGF- alpha and amphiregulin. Amplified in breast cancer. Overexpression induces constitutive activity, and the gene is amplified or overexpressed in up to 30% of breast cancers, correlating with poor survival. The antibody Herceptin is approved for treatment of metastatic breast cancer with HER2 amplification/overexpression. Somatic mutations seen in 4% of lung cancers and also in breast, gastric, ovarian cancer and glioblastoma. One SNP shows predisposition to breast and gastric cancer. Inhibitors: Herceptin, lapatinib, PKI-166, EKB-569, CI-1033. Protein type: EC 2.7.10.1; EGFR family; Kinase, protein; Membrane protein, integral; Oncoprotein; Protein kinase, TK; Protein kinase, tyrosine (receptor); TK group. Chromosomal Location of Human Ortholog: 17q12. Cellular Component: basolateral plasma membrane; cytosol; endosome membrane; nucleus; plasma membrane; receptor complex. Molecular Function: ErbB-3 class receptor binding; growth factor binding; identical protein binding; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; protein binding; protein C-terminus binding; protein heterodimerization activity; protein phosphatase binding; protein-tyrosine kinase activity; Ras guanyl-nucleotide exchange factor activity; transmembrane receptor activity; transmembrane receptor protein tyrosine kinase activity. Biological Process: cell proliferation; cell surface receptor linked signal transduction; enzyme linked receptor protein signaling pathway; MAPKKK cascade; phosphoinositide 3-kinase cascade; phosphoinositide-mediated signaling; positive regulation of cell adhesion; positive regulation of cell growth; positive regulation of epithelial cell proliferation; positive regulation of GTPase activity; positive regulation of MAP kinase activity; positive regulation of protein amino acid phosphorylation; positive regulation of transcription from RNA polymerase I promoter; positive regulation of transcription from RNA polymerase III promoter; positive regulation of translation; protein amino acid autophosphorylation; protein amino acid phosphorylation; regulation of microtubule-based process; regulation of phosphoinositide 3-kinase cascade; regulation of transcription from RNA polymerase II promoter; signal transduction; transmembrane receptor protein tyrosine kinase signaling pathway; wound healing. Disease: Gastric Cancer; Glioma Susceptibility 1; Lung Cancer
size1 :
0.01 mg
price1 :
180 USD
size2 :
0.05 mg
price2 :
225
size3 :
0.1 mg
price3 :
320
size4 :
0.2 mg
price4 :
500
size5 :
0.5 mg
price5 :
800
size6 :
1 mg
price6 :
1235
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!