product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Bos taurus (Bovine) Cytosol aminopeptidase
catalog :
MBS9421174
quantity :
0.01 mg
price :
265 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9421174
products type :
Recombinant Protein
products full name :
Recombinant Bos taurus (Bovine) Cytosol aminopeptidase
products short name :
[Cytosol aminopeptidase]
products name syn :
[Leucine aminopeptidase 3; LAP-3Leucyl aminopeptidasePeptidase SProline aminopeptidase (EC:3.4.11.5)Prolyl aminopeptidase]
other names :
[cytosol aminopeptidase; Cytosol aminopeptidase; cytosol aminopeptidase; Leucine aminopeptidase 3; LAP-3; Leucyl aminopeptidase; Peptidase S; Proline aminopeptidase (EC:3.4.11.5); Prolyl aminopeptidase]
products gene name :
[AMPL]
other gene names :
[LAP3; LAP3; PEPS; LAP-3; LAP-3]
host :
E Coli
sequence positions :
[Partial, 25-64aa]
sequence :
VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRR
K
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Immunogen Description: Expression Region:25-64aaSequence Info:Full Length. Calculated MW: 20.5 kDa. Tag Info: N-terminal 6xHis-SUMO-tagged
products description :
Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the roval of unsubstituted N-terminal amino acids from various peptides.
ncbi gi num :
165905571
ncbi acc num :
NP_776523.2
ncbi gb acc num :
NM_174098.3
uniprot acc num :
Q28880
ncbi pathways :
Arginine And Proline Metabolism Pathway (84202); Arginine And Proline Metabolism Pathway (323); Glutathione Metabolism Pathway (84216); Glutathione Metabolism Pathway (343)
uniprot summary :
LAP3: Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides. Belongs to the peptidase M17 family. 2 isoforms of the human protein are produced by alternative initiation. Protein type: Amino Acid Metabolism - arginine and proline; EC 3.4.11.1; EC 3.4.11.5; Mitochondrial; Other Amino Acids Metabolism - glutathione; Protease. Cellular Component: cytoplasm; mitochondrion. Molecular Function: peptidase activity
size1 :
0.01 mg
price1 :
265 USD
size2 :
0.05 mg
price2 :
350
size3 :
0.1 mg
price3 :
560
size4 :
0.2 mg
price4 :
880
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!